GIMAP7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81624

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: FHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for GIMAP7 Antibody - BSA Free

Western Blot: GIMAP7 Antibody [NBP1-81624]

Western Blot: GIMAP7 Antibody [NBP1-81624]

Western Blot: GIMAP7 Antibody [NBP1-81624] - Analysis in control (vector only transfected HEK293T lysate) and GIMAP7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
GIMAP7 Antibody - BSA Free Immunohistochemistry-Paraffin: GIMAP7 Antibody [NBP1-81624]

Immunohistochemistry-Paraffin: GIMAP7 Antibody [NBP1-81624]

Analysis in human lymph node and skin tissues. Corresponding RNA-seq data are presented for the same tissues.
GIMAP7 Antibody - BSA Free Immunohistochemistry-Paraffin: GIMAP7 Antibody [NBP1-81624]

Immunohistochemistry-Paraffin: GIMAP7 Antibody [NBP1-81624]

Staining of human skin shows negative to very weak positivity in squamous epithelial cells.
GIMAP7 Antibody - BSA Free Immunohistochemistry-Paraffin: GIMAP7 Antibody [NBP1-81624]

Immunohistochemistry-Paraffin: GIMAP7 Antibody [NBP1-81624]

Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
GIMAP7 Antibody - BSA Free Immunohistochemistry-Paraffin: GIMAP7 Antibody [NBP1-81624]

Immunohistochemistry-Paraffin: GIMAP7 Antibody [NBP1-81624]

Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.
GIMAP7 Antibody - BSA Free Immunohistochemistry-Paraffin: GIMAP7 Antibody [NBP1-81624]

Immunohistochemistry-Paraffin: GIMAP7 Antibody [NBP1-81624]

Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Applications for GIMAP7 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: GIMAP7

GIMAP7 encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1.

Alternate Names

GTPase, IMAP family member 7, hIAN7, IAN-7, IAN7GTPase IMAP family member 7, immune associated nucleotide, Immunity-associated nucleotide 7 protein, MGC27027

Gene Symbol

GIMAP7

Additional GIMAP7 Products

Product Documents for GIMAP7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for GIMAP7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GIMAP7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GIMAP7 Antibody - BSA Free and earn rewards!

Have you used GIMAP7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...