Glucosylceramidase/GBA Antibody (8O3Z7)
Novus Biologicals | Catalog # NBP3-15637
Recombinant Monoclonal Antibody
![Western Blot: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637]](https://resources.rndsystems.com/images/products/Glucosylceramidase-GBA-Antibody-8O3Z7-Western-Blot-NBP3-15637-img0002.jpg "Western Blot: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637]")
Loading...
Key Product Details
Species Reactivity
Human, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 8O3Z7 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 437-536 of human Glucosylceramidase/GBA (P04062). VDSPIIVDITKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASQKNDLDAVALMHPDGSAVVVVLNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Glucosylceramidase/GBA Antibody (8O3Z7)
Western Blot: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637]
Western Blot: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637] - Western blot analysis of extracts of various cell lines, using Glucosylceramidase beta (Glucosylceramidase/GBA) antibody (NBP3-15637) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.![Western Blot: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637]](https://resources.rndsystems.com/images/products/Glucosylceramidase-GBA-Antibody-8O3Z7-Western-Blot-NBP3-15637-img0003.jpg "Western Blot: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637]")
Western Blot: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637]
Western Blot: Glucosylceramidase/GBA Antibody (8O3Z7) [NBP3-15637] - Western blot analysis of extracts of Rat brain, using Glucosylceramidase beta (Glucosylceramidase/GBA) antibody (NBP3-15637) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] -
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Glucosylceramidase/GBA Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] -
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using Glucosylceramidase/GBA Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] -
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Glucosylceramidase/GBA Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] -
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using Glucosylceramidase/GBA Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] -
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] - Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using Glucosylceramidase/GBA Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] -
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Glucosylceramidase/GBA Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] -
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Glucosylceramidase/GBA Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] -
Immunohistochemistry: Glucosylceramidase/GBA Antibody (8O3Z7) [Glucosylceramidase/GBA] - Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using Glucosylceramidase/GBA Rabbit mAb at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.Applications for Glucosylceramidase/GBA Antibody (8O3Z7)
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Western Blot
1:500 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Glucosylceramidase/GBA
Alternate Names
Alglucerase, GBA, GBA1, Imiglucerase
Gene Symbol
GBA1
Additional Glucosylceramidase/GBA Products
Product Documents for Glucosylceramidase/GBA Antibody (8O3Z7)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Glucosylceramidase/GBA Antibody (8O3Z7)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Glucosylceramidase/GBA Antibody (8O3Z7)
There are currently no reviews for this product. Be the first to review Glucosylceramidase/GBA Antibody (8O3Z7) and earn rewards!
Have you used Glucosylceramidase/GBA Antibody (8O3Z7)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...