Glutamate Dehydrogenase Antibody (7L7N2)

Novus Biologicals | Catalog # NBP3-16582

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7L7N2 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 459-558 of human Glutamate Dehydrogenase (P00367). ERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glutamate Dehydrogenase Antibody (7L7N2)

Western Blot: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582]

Western Blot: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582]

Western Blot: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] - Analysis of extracts of various cell lines, using Glutamate Dehydrogenase Rabbit mAb (NBP3-16582) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582]

Immunocytochemistry/ Immunofluorescence: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582]

Immunocytochemistry/Immunofluorescence: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] - Immunofluorescence analysis of NIH-3T3 cells using Glutamate Dehydrogenase Rabbit mAb (NBP3-16582) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582]

Western Blot: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582]

Western Blot: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] - Analysis of extracts of various cell lines, using Glutamate Dehydrogenase Rabbit mAb (NBP3-16582) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Glutamate Dehydrogenase Antibody (7L7N2)

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] -

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] - Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Glutamate Dehydrogenase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Glutamate Dehydrogenase Antibody (7L7N2)

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] -

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using Glutamate Dehydrogenase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Glutamate Dehydrogenase Antibody (7L7N2)

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] -

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Glutamate Dehydrogenase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Glutamate Dehydrogenase Antibody (7L7N2)

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] -

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using Glutamate Dehydrogenase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Glutamate Dehydrogenase Antibody (7L7N2)

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] -

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] - Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Glutamate Dehydrogenase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Glutamate Dehydrogenase Antibody (7L7N2)

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] -

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Glutamate Dehydrogenase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Glutamate Dehydrogenase Antibody (7L7N2)

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] -

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Glutamate Dehydrogenase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Glutamate Dehydrogenase Antibody (7L7N2)

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] -

Immunohistochemistry: Glutamate Dehydrogenase Antibody (7L7N2) [NBP3-16582] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Glutamate Dehydrogenase Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for Glutamate Dehydrogenase Antibody (7L7N2)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Glutamate Dehydrogenase 1/GLUD1

One enzyme central to the metabolism of glutamate is glutamate dehydrogenase (GDH1; EC 1.4.1.3), that catalyzes the reversible deamination of L-glutamate to 2-oxoglutarate using NAD+ or NADP+. Mammalian GDH is composed of six identical subunits, and the regulation of GDH is very complex. It has been a major goal to identify the substrate and regulatory binding sites of GDH. It is only in recent years that the three-dimensional structure of GDH from microorganisms is available. Very recently, crystallization of bovine liver GDH was reported for the first time from the mammalian sources. However, remarkably little is known about the detailed structure of mammalian GDH, especially the brain enzymes.

Alternate Names

GDH, GDH1

Gene Symbol

GLUD1

Additional Glutamate Dehydrogenase 1/GLUD1 Products

Product Documents for Glutamate Dehydrogenase Antibody (7L7N2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glutamate Dehydrogenase Antibody (7L7N2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glutamate Dehydrogenase Antibody (7L7N2)

There are currently no reviews for this product. Be the first to review Glutamate Dehydrogenase Antibody (7L7N2) and earn rewards!

Have you used Glutamate Dehydrogenase Antibody (7L7N2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...