Glutamate Rich 5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-93788

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QPQGTVGKDEQAPLLETISKENESPEILEGSQFVETAEEQQLQATLGKEEQPQLLERIPKENVTPEVLDRSQLVEK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glutamate Rich 5 Antibody - BSA Free

Western Blot: Glutamate Rich 5 Antibody [NBP1-93788]

Western Blot: Glutamate Rich 5 Antibody [NBP1-93788]

Western Blot: C8orf47 Antibody [NBP1-93788] - Analysis in control (vector only transfected HEK293T lysate) and ERICH5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Glutamate Rich 5 Antibody [NBP1-93788]

Immunohistochemistry-Paraffin: Glutamate Rich 5 Antibody [NBP1-93788]

Immunohistochemistry-Paraffin: C8orf47 Antibody [NBP1-93788] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Glutamate Rich 5 Antibody [NBP1-93788]

Immunohistochemistry-Paraffin: Glutamate Rich 5 Antibody [NBP1-93788]

Immunohistochemistry-Paraffin: C8orf47 Antibody [NBP1-93788] - Staining of human fallopian tube shows high expression.
Glutamate Rich 5 Antibody - BSA Free Western Blot: Glutamate Rich 5 Antibody - BSA Free [NBP1-93788]

Western Blot: Glutamate Rich 5 Antibody - BSA Free [NBP1-93788]

Analysis in human cell line RT-4.
Glutamate Rich 5 Antibody - BSA Free Western Blot: Glutamate Rich 5 Antibody - BSA Free [NBP1-93788]

Western Blot: Glutamate Rich 5 Antibody - BSA Free [NBP1-93788]

Analysis in control (vector only transfected HEK293T lysate) and ERICH5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Glutamate Rich 5 Antibody - BSA Free Immunohistochemistry: Glutamate Rich 5 Antibody - BSA Free [NBP1-93788]

Immunohistochemistry: Glutamate Rich 5 Antibody - BSA Free [NBP1-93788]

Analysis in human fallopian tube and cerebral cortex tissues using Anti-ERICH5 antibody. Corresponding ERICH5 RNA-seq data are presented for the same tissues.

Applications for Glutamate Rich 5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glutamate Rich 5

Alternate Names

chromosome 8 open reading frame 47

Gene Symbol

C8orf47

Additional Glutamate Rich 5 Products

Product Documents for Glutamate Rich 5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glutamate Rich 5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glutamate Rich 5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glutamate Rich 5 Antibody - BSA Free and earn rewards!

Have you used Glutamate Rich 5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...