Glutathione Peroxidase 2/GPX2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03209

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Glutathione Peroxidase 2/GPX2 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 100-180 of human Glutathione Peroxidase 2/GPX2 (NP_002074.2). TLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Glutathione Peroxidase 2/GPX2 Antibody - BSA Free

Western Blot: Glutathione Peroxidase 2/GPX2 AntibodyAzide and BSA Free [NBP3-03209]

Western Blot: Glutathione Peroxidase 2/GPX2 AntibodyAzide and BSA Free [NBP3-03209]

Western Blot: Glutathione Peroxidase 2/GPX2 Antibody [NBP3-03209] - Analysis of extracts of various cell lines, using Glutathione Peroxidase 2/GPx2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Immunohistochemistry-Paraffin: Glutathione Peroxidase 2/GPX2 Antibody - Azide and BSA Free [NBP3-03209]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 2/GPX2 Antibody - Azide and BSA Free [NBP3-03209]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 2/GPX2 Antibody [NBP3-03209] - Mouse stomach using Glutathione Peroxidase 2/GPx2 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: Glutathione Peroxidase 2/GPX2 Antibody - Azide and BSA Free [NBP3-03209]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 2/GPX2 Antibody - Azide and BSA Free [NBP3-03209]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 2/GPX2 Antibody [NBP3-03209] - Human colon carcinoma using Glutathione Peroxidase 2/GPx2 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: Glutathione Peroxidase 2/GPX2 Antibody - Azide and BSA Free [NBP3-03209]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 2/GPX2 Antibody - Azide and BSA Free [NBP3-03209]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 2/GPX2 Antibody [NBP3-03209] - Rat stomach using Glutathione Peroxidase 2/GPx2 antibody at dilution of 1:100 (40x lens).

Applications for Glutathione Peroxidase 2/GPX2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Glutathione Peroxidase 2/GPX2

Glutathione Peroxidase 2 is a member of the glutathione peroxidase family and encodes a selenium-dependent glutathione peroxidase that is one of two isoenzymes responsible for the majority of the glutathione-dependent hydrogen peroxide-reducing activity in the epithelium of the gastrointestinal tract. Studies in knockout mice indicate that mRNA expression levels respond to luminal microflora, suggesting a role of the ileal glutathione peroxidases in preventing inflammation in the GI tract.

Alternate Names

GIGPX, GPRP, GPX2

Gene Symbol

GPX2

Additional Glutathione Peroxidase 2/GPX2 Products

Product Documents for Glutathione Peroxidase 2/GPX2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Glutathione Peroxidase 2/GPX2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Related Research Areas

Oxidative Stress
Redox Enzymes

Customer Reviews for Glutathione Peroxidase 2/GPX2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glutathione Peroxidase 2/GPX2 Antibody - BSA Free and earn rewards!

Have you used Glutathione Peroxidase 2/GPX2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies