Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54691

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to GPX4(glutathione peroxidase 4 (phospholipid hydroperoxidase)) The peptide sequence was selected from the middle region of GPX4. Peptide sequence QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

Western Blot: Glutathione Peroxidase 4/GPX4 Antibody [NBP1-54691]

Western Blot: Glutathione Peroxidase 4/GPX4 Antibody [NBP1-54691]

Western Blot: Glutathione Peroxidase 4/GPX4 Antibody [NBP1-54691] - 25 ug of indicated human cell extracts were loaded onto a 10% - 20% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. Recommended dilution for NBP1-54691 is 1 - 3 ug/mL. Recognizes 19 kDa cytoplasmic form in these cell lines, mitochondrial form of 22 kDa appears absent in these samples.
Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP1-54691]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP1-54691]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP1-54691] - Human Heart Tissue, antibody concentration 5 ug/ml.

Applications for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml
Application Notes
It is recommended to stain paraffin-embedded tissue samples with the antibody at 5ug/ml after heat-induced antigen retrieval with Sodium citrate buffer.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glutathione Peroxidase 4/GPX4

Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

Alternate Names

GPX4, PHGPx, snGPx

Gene Symbol

GPX4

UniProt

Additional Glutathione Peroxidase 4/GPX4 Products

Product Documents for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glutathione Peroxidase 4/GPX4 Antibody - BSA Free and earn rewards!

Have you used Glutathione Peroxidase 4/GPX4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...