Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-54979

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (92%), Rat (90%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHY

Reactivity Notes

Use in Human reported in scientific literature (PMID:33707434).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Staining in human testis and pancreas tissues using anti-GPX4 antibody. Corresponding GPX4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979]

Immunohistochemistry-Paraffin: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Staining of human pancreas shows low expression as expected.
Glutathione Peroxidase 4/GPX4 Antibody

Immunohistochemistry: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] -

nbp2-54979_rabbit-polyclonal-glutathione-peroxidase-4-gpx4-antibody-20920231412570.jpg
Glutathione Peroxidase 4/GPX4 Antibody

Immunohistochemistry: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] -

Immunohistochemistry: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - Cyst(e)ine promotes GPX4 protein synthesis partly through Rag-mTORC1-4EBP signaling. i WB analysis of protein expression in control (sgCon) & 4EBP1/2-double-knockout (DKO-1 & DKO-2) UMRC6 cells. Image collected & cropped by CiteAb from following publication (https://pubmed.ncbi.nlm.nih.gov/33707434), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
Glutathione Peroxidase 4/GPX4 Antibody

Immunohistochemistry: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] -

Immunohistochemistry: Glutathione Peroxidase 4/GPX4 Antibody [NBP2-54979] - mTORC1 inhibition sensitizes cancer cells or tumors to ferroptosis.a UMRC6 cells were treated with 1 μM RSL3 (or 1 μM ML162), or 1 μM Torin1, or both combined with or without 5 μM Ferrostatin-1 (Ferr-1) or 100 μM deferoxamine (DFO) for 6 h. Then lipid peroxidation was assessed using BODIPY™ 581/591 C11 staining followed by FACS analysis. b Bar graph showing the viability of UMRC6 cells treated with drugs using indicated combination. Concentration of each drug is described as follows. RSL3, 1 μM; ML162, 1 μM; Torin1, 1 μM; Ferr-1, 5 μM; DFO, 100 μM. n = 3. c Bar graph showing the viability of indicated cells treated with 300 nM RSL3, or 1 μM Torin1, or both for 8 h. n = 5. d Bar graph showing the viability of indicated cells treated with 300 nM ML162, or 1 μM Torin1, or both for 8 h. n = 5. e Bar graph showing the viability of indicated cells treated with different concentrations of cystine for 48 h. n = 4. f Plot showing the viability of indicated cells treated with different concentrations of erastin for 36 h. n = 4. g Volumes of PDX tumors in mice treated daily with 30 mg/kg IKE, or 10 mg/kg AZD8055, or both at different time points as shown. n = 5 mice per group. h Percentages of P-4EBP1-, GPX4-, or 4-HNE-positive stained cells per field. n = 5 randomly selected high-power fields per group. i Haematoxylin & eosin & immunohistochemical staining of PDX tumor samples collected from mice at the end of treatments described in g. For all panels, error bars are mean ± SD. If not otherwise specified, n indicates biologically independent repeats. P value was determined by two-tailed unpaired Student’s t test. For f & g, p value was determined by two-way ANOVA test. Source data are provided as a Source Data file. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33707434), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glutathione Peroxidase 4/GPX4

Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists; alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

Alternate Names

GPX4, PHGPx, snGPx

Gene Symbol

GPX4

Additional Glutathione Peroxidase 4/GPX4 Products

Product Documents for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

Customer Reviews for Glutathione Peroxidase 4/GPX4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glutathione Peroxidase 4/GPX4 Antibody - BSA Free and earn rewards!

Have you used Glutathione Peroxidase 4/GPX4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...