Glycophorin C Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84597

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Glycophorin C Antibody - BSA Free

Glycophorin C Antibody - BSA Free Western Blot: Glycophorin C Antibody - BSA Free [NBP1-84597]

Western Blot: Glycophorin C Antibody - BSA Free [NBP1-84597]

Analysis in control (vector only transfected HEK293T lysate) and GYPC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419537).
Glycophorin C Antibody - BSA Free Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597]

Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597]

Analysis in human bone marrow and pancreas tissues. Corresponding RNA-seq data are presented for the same tissues.
Glycophorin C Antibody - BSA Free Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597]

Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597]

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Glycophorin C Antibody - BSA Free Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597]

Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597]

Staining of human placenta shows strong membranous positivity in erythrocytes.
Glycophorin C Antibody - BSA Free Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597]

Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597]

Staining of human bone marrow shows strong membranous positivity in erythrocytes.
Glycophorin C Antibody - BSA Free Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597]

Immunohistochemistry-Paraffin: Glycophorin C Antibody [NBP1-84597]

Staining of human cerebral cortex shows no positivity in neurons as expected.

Applications for Glycophorin C Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Glycophorin C

Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, butplays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations havebeen described. The Gerbich and Yus phenotypes are due to deletion of exon 3 and 2, respectively. The Webb and Duchantigens, also known as glycophorin D, result from single point mutations of the glycophorin C gene. The glycophorin Cprotein has very little homology with glycophorins A and B. (provided by RefSeq)

Alternate Names

CD236, CD236 antigen, CD236R, Ge, GLPC, Glycoconnectin, glycophorin C (Gerbich blood group), glycophorin-C, Glycophorin-D, Glycoprotein beta, GPCMGC126191, GPD, GYPD, MGC117309, MGC126192, PAS-2, PAS-2', Sialoglycoprotein D

Gene Symbol

GYPC

Additional Glycophorin C Products

Product Documents for Glycophorin C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Glycophorin C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Glycophorin C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Glycophorin C Antibody - BSA Free and earn rewards!

Have you used Glycophorin C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...