GPIP137 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38483

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all GPIP137 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human GPIP137 (NP_005889.3).

Sequence:
AEEYTEQSEVESTEYVNRQFMAETQFTSGEKEQVDEWTVETVEVVNSLQQQPQAASPSVPEPHSLTPVAQADPLVRRQRVQDLMAQMQGPYNFIQDSMLDFENQTLDPAIVSAQPMNPTQNMDMPQLVCPPVHSESRLAQPNQVPVQPEATQVPLV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for GPIP137 Antibody - BSA Free

GPIP137 Antibody

Immunocytochemistry/ Immunofluorescence: GPIP137 Antibody [NBP3-38483] -

Immunocytochemistry/ Immunofluorescence: GPIP137 Antibody [NBP3-38483] - Immunofluorescence analysis of U-2 OS cells using GPIP137 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
GPIP137 Antibody

Western Blot: GPIP137 Antibody [NBP3-38483] -

Western Blot: GPIP137 Antibody [NBP3-38483] - Western blot analysis of lysates from HeLa cells, using GPIP137 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
GPIP137 Antibody

Immunocytochemistry/ Immunofluorescence: GPIP137 Antibody [NBP3-38483] -

Immunocytochemistry/ Immunofluorescence: GPIP137 Antibody [NBP3-38483] - Immunofluorescence analysis of L929 cells using GPIP137 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
GPIP137 Antibody

Western Blot: GPIP137 Antibody [NBP3-38483] -

Western Blot: GPIP137 Antibody [NBP3-38483] - Western blot analysis of lysates from Mouse brain, using GPIP137 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
GPIP137 Antibody

Immunocytochemistry/ Immunofluorescence: GPIP137 Antibody [NBP3-38483] -

Immunocytochemistry/ Immunofluorescence: GPIP137 Antibody [NBP3-38483] - Immunofluorescence analysis of C6 cells using GPIP137 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for GPIP137 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: GPIP137

GPIP137 may regulate the transport and translation of mRNAs of proteins involved in synaptic plasticity in neurons and cell proliferation and migration in multiple cell types

Alternate Names

activation/proliferation-associated protein 1, caprin 1, caprin-1, cell cycle associated protein 1, Cell cycle-associated protein 1, Cytoplasmic activation- and proliferation-associated protein 1, cytoplasmic activation/proliferation-associated protein-1, GPI-anchored membrane protein 1GPIP137, GPI-p137, M11S1GPI-anchored protein p137, Membrane component chromosome 11 surface marker 1, membrane component, chromosome 11, surface marker 1, p137GPI, RNA granule protein 105, RNG105GPIAP1

Gene Symbol

CAPRIN1

Additional GPIP137 Products

Product Documents for GPIP137 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for GPIP137 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for GPIP137 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review GPIP137 Antibody - BSA Free and earn rewards!

Have you used GPIP137 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies