Guanylate kinase Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14078

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Guanylate Kinase Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: LRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Guanylate kinase Antibody - BSA Free

Western Blot: Guanylate kinase Antibody [NBP2-14078]

Western Blot: Guanylate kinase Antibody [NBP2-14078]

Western Blot: Guanylate kinase Antibody [NBP2-14078] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078]

Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078]

Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078]

Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078]

Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078]

Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078]

Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078]

Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078]

Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078]

Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078]

Immunohistochemistry-Paraffin: Guanylate kinase Antibody [NBP2-14078] - Staining of human skeletal muscle shows very weak positivity in myocytes as expected.
Guanylate kinase Antibody Western Blot: Guanylate kinase Antibody Antibody [NBP2-14078]

Western Blot: Guanylate kinase Antibody Antibody [NBP2-14078]

Analysis using NBP2-14078 (A) shows similar pattern to independent antibody NBP2-76521 (B).

Applications for Guanylate kinase Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000-1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Guanylate Kinase

Essential for recycling GMP and indirectly, cGMP

Alternate Names

ATP:GMP Phosphotransferase, Deoxyguanylate Kinase, GMK, GMP Kinase, Guanosine monophosphate Kinase, GUK1

Gene Symbol

GUK1

Additional Guanylate Kinase Products

Product Documents for Guanylate kinase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Guanylate kinase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Intracellular Kinases

Customer Reviews for Guanylate kinase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Guanylate kinase Antibody - BSA Free and earn rewards!

Have you used Guanylate kinase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies