HADHB Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-82609
Loading...
Key Product Details
Validated by
Knockout/Knockdown, Independent Antibodies
Species Reactivity
Validated:
Human, Mouse, Rat
Cited:
Mouse
Applications
Validated:
Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNWGGSLSLG
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for HADHB Antibody - BSA Free
Immunohistochemistry: HADHB Antibody [NBP1-82609]
HADHB-Antibody-Immunohistochemistry-NBP1-82609-img0015.jpgWestern Blot: HADHB Antibody [NBP1-82609]
Western Blot: HADHB Antibody [NBP1-82609] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609]
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609]
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609]
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609]
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.Western Blot: HADHB Antibody [NBP1-82609] -
Western Blot: HADHB Antibody [NBP1-82609] - Identification of Proteins Binding Pre-miR-329 & Pre-miR-495(A) Schematic representation of RNA pull-down combined with SILAC mass spectrometry. (B) Proteins showing increased or decreased binding to pre-miR-329, pre-miR-495, or both. (C) Western blot validation of HADHB & CIRBP binding to pre-miR-329 & pre-miR-495 under conditions of normal serum & serum starvation. DHX9 is used as a binding control. (D & E) Quantification of the western blot, showing HADHB (D) & CIRBP (E) binding to pre-miR-329 & pre-miR-495 under conditions of normal serum & serum starvation (relative to input). *p < 0.05, n = 3. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30665182), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: HADHB Antibody [NBP1-82609] -
Western Blot: HADHB Antibody [NBP1-82609] - Generation of NIH 3T3 HADHB KO Cell Lines by CRISPR/Cas9(A) Western blot analysis of HADHB protein levels in two HADHB KO clones (AQ & Z) compared with decreasing amounts of total protein extract from WT NIH 3T3 cells. (B) Alignment of the region surrounding the CRISPR-Cas9 target sequence from genomic DNA of clones AQ & Z. (C & D) Levels of mature (C) or precursor (D) miR-329 & miR-495 as well as control miR-423 in WT & HADHB KO cell lines quantified by qRT-PCR & normalized to miR-16. For pre-miRs, n = 3; for mature miRs, n = 9. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30665182), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: HADHB Antibody [NBP1-82609] -
Western Blot: HADHB Antibody [NBP1-82609] - Expression of CIRBP & HADHB In Vivo(A & B) Immunohistochemical staining of murine adductor muscle after ischemia induction revealed expression of both CIRBP (A) & HADHB (B) in these tissues, predominantly in the cytoplasm of cells. (C & D) Microarray analysis of mRNA expression of CIRBP (C) & HADHB (D) mRNA in the adductor muscle of mice at several time points after induction of ischemia (4 mice per time point). (E) Western blot showing HADHB levels in murine adductor muscle tissue on day 0, day 1, & day 3 after hindlimb ligation. For each time point, samples from right (R) unligated paws & left (L) ligated paws are presented next to each other. Tubulin was used as a loading control. (F) Quantification of the western blot. The HADHB signal was normalized against tubulin, & the relative change between ligated & unligated is presented. Each bar represents a biological triplicate & technical duplicate. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30665182), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for HADHB Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:500 - 1:1000
Immunohistochemistry-Paraffin
1:500 - 1:1000
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: HADHB
Alternate Names
2-enoyl-Coenzyme A (CoA) hydratase, beta subunit, 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein, acetyl-CoA acyltransferase, beta subunit, beta-ketothiolase, EC 2.3.1, EC 2.3.1.16, ECHB, hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit, hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit, hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit, MGC87480, mitochondrial trifunctional enzyme, beta subunit, mitochondrial trifunctional protein, beta subunit, MTPB, TP-beta, trifunctional enzyme subunit beta, mitochondrial
Gene Symbol
HADHB
Additional HADHB Products
Product Documents for HADHB Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for HADHB Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for HADHB Antibody - BSA Free
Customer Reviews for HADHB Antibody - BSA Free
There are currently no reviews for this product. Be the first to review HADHB Antibody - BSA Free and earn rewards!
Have you used HADHB Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...