HADHB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82609

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Independent Antibodies

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Mouse

Applications

Validated:

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LRDFMYVSQDPKDQLLLGPTYATPKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNNWGGSLSLG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HADHB Antibody - BSA Free

Knockout Validated: HADHB Antibody [NBP1-82609]

Western Blot: HADHB Antibody [NBP1-82609]

HADHB-Antibody-Knockout-Validated-NBP1-82609-img0016.jpg
Immunohistochemistry: HADHB Antibody [NBP1-82609]

Immunohistochemistry: HADHB Antibody [NBP1-82609]

HADHB-Antibody-Immunohistochemistry-NBP1-82609-img0015.jpg
Western Blot: HADHB Antibody [NBP1-82609]

Western Blot: HADHB Antibody [NBP1-82609]

Western Blot: HADHB Antibody [NBP1-82609] - Analysis using Anti-HADHB antibody NBP1-82609 (A) shows similar pattern to independent antibody NBP2-38353 (B).
Western Blot: HADHB Antibody [NBP1-82609]

Western Blot: HADHB Antibody [NBP1-82609]

Western Blot: HADHB Antibody [NBP1-82609] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609]

Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609]

Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human heart muscle shows strong granular cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609]

Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609]

Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609]

Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609]

Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609]

Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609]

Immunohistochemistry-Paraffin: HADHB Antibody [NBP1-82609] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
HADHB Antibody

Western Blot: HADHB Antibody [NBP1-82609] -

Western Blot: HADHB Antibody [NBP1-82609] - Identification of Proteins Binding Pre-miR-329 & Pre-miR-495(A) Schematic representation of RNA pull-down combined with SILAC mass spectrometry. (B) Proteins showing increased or decreased binding to pre-miR-329, pre-miR-495, or both. (C) Western blot validation of HADHB & CIRBP binding to pre-miR-329 & pre-miR-495 under conditions of normal serum & serum starvation. DHX9 is used as a binding control. (D & E) Quantification of the western blot, showing HADHB (D) & CIRBP (E) binding to pre-miR-329 & pre-miR-495 under conditions of normal serum & serum starvation (relative to input). *p < 0.05, n = 3. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30665182), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
HADHB Antibody

Western Blot: HADHB Antibody [NBP1-82609] -

Western Blot: HADHB Antibody [NBP1-82609] - Generation of NIH 3T3 HADHB KO Cell Lines by CRISPR/Cas9(A) Western blot analysis of HADHB protein levels in two HADHB KO clones (AQ & Z) compared with decreasing amounts of total protein extract from WT NIH 3T3 cells. (B) Alignment of the region surrounding the CRISPR-Cas9 target sequence from genomic DNA of clones AQ & Z. (C & D) Levels of mature (C) or precursor (D) miR-329 & miR-495 as well as control miR-423 in WT & HADHB KO cell lines quantified by qRT-PCR & normalized to miR-16. For pre-miRs, n = 3; for mature miRs, n = 9. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30665182), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
HADHB Antibody

Western Blot: HADHB Antibody [NBP1-82609] -

Western Blot: HADHB Antibody [NBP1-82609] - Expression of CIRBP & HADHB In Vivo(A & B) Immunohistochemical staining of murine adductor muscle after ischemia induction revealed expression of both CIRBP (A) & HADHB (B) in these tissues, predominantly in the cytoplasm of cells. (C & D) Microarray analysis of mRNA expression of CIRBP (C) & HADHB (D) mRNA in the adductor muscle of mice at several time points after induction of ischemia (4 mice per time point). (E) Western blot showing HADHB levels in murine adductor muscle tissue on day 0, day 1, & day 3 after hindlimb ligation. For each time point, samples from right (R) unligated paws & left (L) ligated paws are presented next to each other. Tubulin was used as a loading control. (F) Quantification of the western blot. The HADHB signal was normalized against tubulin, & the relative change between ligated & unligated is presented. Each bar represents a biological triplicate & technical duplicate. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/30665182), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for HADHB Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HADHB

HADHB encodes the beta subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the beta subunit catalyzing the 3-ketoacyl-CoA thiolase activity. Mutations in this gene result in trifunctional protein deficiency. The encoded protein can also bind RNA and decreases the stability of some mRNAs. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation. Alternatively spliced transcript variants have been found; however, their full-length nature is not known. [provided by RefSeq]

Alternate Names

2-enoyl-Coenzyme A (CoA) hydratase, beta subunit, 3-ketoacyl-Coenzyme A (CoA) thiolase of mitochondrial trifunctional protein, acetyl-CoA acyltransferase, beta subunit, beta-ketothiolase, EC 2.3.1, EC 2.3.1.16, ECHB, hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase(trifunctional protein), beta subunit, hydroxyacyl-Coenzyme A (CoA) dehydrogenase, beta subunit, hydroxyacyl-Coenzyme A dehydrogenase/3-ketoacyl-Coenzyme Athiolase/enoyl-Coenzyme A hydratase (trifunctional protein), beta subunit, MGC87480, mitochondrial trifunctional enzyme, beta subunit, mitochondrial trifunctional protein, beta subunit, MTPB, TP-beta, trifunctional enzyme subunit beta, mitochondrial

Gene Symbol

HADHB

Additional HADHB Products

Product Documents for HADHB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HADHB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HADHB Antibody - BSA Free

Customer Reviews for HADHB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HADHB Antibody - BSA Free and earn rewards!

Have you used HADHB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...