HAPLN1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85443

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Predicted:

Rat (92%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIH

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HAPLN1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: HAPLN1 Antibody [NBP1-85443]

Immunocytochemistry/ Immunofluorescence: HAPLN1 Antibody [NBP1-85443]

Immunocytochemistry/Immunofluorescence: HAPLN1 Antibody [NBP1-85443] - Staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining of human colon.
Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining of human placenta shows high expression.
Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining in human placenta and prostate tissues using anti-HAPLN1 antibody. Corresponding HAPLN1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining of human bronchus, cerebral cortex, colon and liver using Anti-HAPLN1 antibody NBP1-85443 (A) shows similar protein distribution across tissues to independent antibody NBP1-84376 (B).
Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining of human bronchus.
Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443]

Immunohistochemistry-Paraffin: HAPLN1 Antibody [NBP1-85443] - Staining of human liver.

Applications for HAPLN1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HAPLN1

Th extracellular matrix of cartilage consists of a number of interacting macromolecules that are unique to that tissue. The most studied group of these molecules are those that make up the ternary complex involving proteoglycan monomer, link protein (LP), and hyaluronic acid (HA). As many as 100 proteoglycan monomers and LPs can be found to interact with a single HA polymer.

Long Name

Hyaluronan and Proteoglycan Link Protein 1

Alternate Names

CRTL1

Gene Symbol

HAPLN1

Additional HAPLN1 Products

Product Documents for HAPLN1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HAPLN1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HAPLN1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HAPLN1 Antibody - BSA Free and earn rewards!

Have you used HAPLN1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Articular Cartilage Extracellular Matrix
Articular Cartilage Extracellular Matrix Thumbnail