HAPLN2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91977

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HAPLN2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HAPLN2 Antibody - BSA Free

Western Blot: HAPLN2 Antibody [NBP1-91977]

Western Blot: HAPLN2 Antibody [NBP1-91977]

Western Blot: HAPLN2 Antibody [NBP1-91977] - Analysis in control (vector only transfected HEK293T lysate) and HAPLN2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977]

Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977]

Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human cerebral cortex shows weak positivity in neuropil.
Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977]

Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977]

Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977]

Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977]

Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human rectum shows no positivity in glandular cells as expected.
HAPLN2 Antibody - BSA Free Western Blot: HAPLN2 Antibody - BSA Free [NBP1-91977]

Western Blot: HAPLN2 Antibody - BSA Free [NBP1-91977]

Analysis in control (vector only transfected HEK293T lysate) and HAPLN2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
HAPLN2 Antibody - BSA Free Immunohistochemistry: HAPLN2 Antibody - BSA Free [NBP1-91977]

Immunohistochemistry: HAPLN2 Antibody - BSA Free [NBP1-91977]

Analysis in human cerebral cortex and kidney tissues using NBP1-91977 antibody. Corresponding HAPLN2 RNA-seq data are presented for the same tissues.
HAPLN2 Antibody - BSA Free Immunohistochemistry: HAPLN2 Antibody - BSA Free [NBP1-91977]

Immunohistochemistry: HAPLN2 Antibody - BSA Free [NBP1-91977]

Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Applications for HAPLN2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HAPLN2

The 340 amino acid long, 37 kDA hyaluronan and proteoglycan link protein 2 encoded by the HAPLN2 gene monitors binding of versication V2 to hyaluronic acid. This protein may be a participant in the formation of the hyaluronan-associated matrix in the central nervous system (CNS). This matrix encourages neuronal confuction and structural stabilization. HAPLN2 participates in PTEN pathway, MAPK signaling, UPA-UPAR pathway, and transendothelial migration of leukocytes. It has been researched regarding its role in rabies, schizophrenia, neuronitis, and malignant glioma.

Long Name

Hyaluronan And Proteoglycan Link Protein 2

Alternate Names

BRAL1

Gene Symbol

HAPLN2

Additional HAPLN2 Products

Product Documents for HAPLN2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HAPLN2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HAPLN2 Antibody - BSA Free

Customer Reviews for HAPLN2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HAPLN2 Antibody - BSA Free and earn rewards!

Have you used HAPLN2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies