HDAC3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-47439

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Histone Deacetylase 3/HDAC3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: QYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit HDAC3 Antibody - BSA Free (NBP2-47439) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for HDAC3 Antibody - BSA Free

Immunohistochemistry: HDAC3 Antibody [NBP2-47439]

Immunohistochemistry: HDAC3 Antibody [NBP2-47439]

Immunohistochemistry: HDAC3 Antibody [NBP2-47439] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.
HDAC3 Antibody Immunocytochemistry/Immunofluorescence: HDAC3 Antibody [NBP2-47439]

Immunocytochemistry/Immunofluorescence: HDAC3 Antibody [NBP2-47439]

Staining of human cell line U-251 MG shows localization to nucleoplasm & the Golgi apparatus.
HDAC3 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: HDAC3 Antibody - BSA Free [NBP2-47439]

Chromatin Immunoprecipitation-exo-Seq: HDAC3 Antibody - BSA Free [NBP2-47439]

ChIP-Exo-Seq composite graph for Anti-HDAC3 (NBP2-47439) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for HDAC3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Histone Deacetylase 3/HDAC3

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone cetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone acetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.

Long Name

Histone Deacetylase 3

Alternate Names

HDAC3, KDAC3, RPD3-2, SMAP45

Gene Symbol

HDAC3

Additional Histone Deacetylase 3/HDAC3 Products

Product Documents for HDAC3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HDAC3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HDAC3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HDAC3 Antibody - BSA Free and earn rewards!

Have you used HDAC3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies