Hexokinase Type III Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38542

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Hexokinase Type III Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human Hexokinase Type III (NP_002106.2).

Sequence:
MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQALRGQASPAPAVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEPRSQEFVIPQEVMLGAGQQLFDFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRSTLISWTKGFRCSGVEGQDVVQLLRDAIRRQGAYNIDVVAVVNDTVGTMMGCEPGVRPCEVGLVVDTGTNACYMEEARHVAVLDEDRGRVCV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

99 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Hexokinase Type III Antibody - BSA Free

Hexokinase Type III Antibody

Immunocytochemistry/ Immunofluorescence: Hexokinase Type III Antibody [NBP3-38542] -

Immunocytochemistry/ Immunofluorescence: Hexokinase Type III Antibody [NBP3-38542] - Immunofluorescence analysis of A-549 cells using Hexokinase Type III Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Hexokinase Type III Antibody

Immunocytochemistry/ Immunofluorescence: Hexokinase Type III Antibody [NBP3-38542] -

Immunocytochemistry/ Immunofluorescence: Hexokinase Type III Antibody [NBP3-38542] - Immunofluorescence analysis of HeLa cells using Hexokinase Type III Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Hexokinase Type III Antibody

Immunocytochemistry/ Immunofluorescence: Hexokinase Type III Antibody [NBP3-38542] -

Immunocytochemistry/ Immunofluorescence: Hexokinase Type III Antibody [NBP3-38542] - Immunofluorescence analysis of NIH/3T3 cells using Hexokinase Type III Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Hexokinase Type III Antibody

Western Blot: Hexokinase Type III Antibody [NBP3-38542] -

Western Blot: Hexokinase Type III Antibody [NBP3-38542] - Western blot analysis of various lysates using Hexokinase Type III Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
Hexokinase Type III Antibody

Immunocytochemistry/ Immunofluorescence: Hexokinase Type III Antibody [NBP3-38542] -

Immunocytochemistry/ Immunofluorescence: Hexokinase Type III Antibody [NBP3-38542] - Immunofluorescence analysis of PC-12 cells using Hexokinase Type III Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Hexokinase Type III Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Hexokinase Type III

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 3. Similar to hexokinases 1 and 2, this allosteric enzyme is inhibited by its product glucose-6-phosphate. [provided by RefSeq]

Long Name

Hexokinase-3

Alternate Names

EC 2.7.1.1, Hexokinase-C, HK III, HK3

Gene Symbol

HK3

Additional Hexokinase Type III Products

Product Documents for Hexokinase Type III Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Hexokinase Type III Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hexokinase Type III Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Hexokinase Type III Antibody - BSA Free and earn rewards!

Have you used Hexokinase Type III Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies