Histatin 3 Antibody (4G9) - Azide and BSA Free

Novus Biologicals | Catalog # H00003347-M01

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Validated:

Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 4G9

Format

Azide and BSA Free
View all Histatin 3 Primary Antibodies »

Product Specifications

Immunogen

HTN3 (AAH09791, 1 a.a. ~ 51 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN

Specificity

HTN3 - histatin 3 (4G9)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Histatin 3 Antibody (4G9) - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Histatin 3 Antibody (4G9) [H00003347-M01]

Immunocytochemistry/ Immunofluorescence: Histatin 3 Antibody (4G9) [H00003347-M01]

Immunocytochemistry/Immunofluorescence: Histatin 3 Antibody (4G9) [H00003347-M01] - Analysis of monoclonal antibody to HTN3 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: Histatin 3 Antibody (4G9) [H00003347-M01] - Detection limit for recombinant GST tagged HTN3 is approximately 3ng/ml as a capture antibody.

Applications for Histatin 3 Antibody (4G9) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against recombinant protein with GST tag on ELISA. GST tag alone is used as a negative control. Use in Western blot reported in scientific literature (PMID: 28055279).

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Histatin 3

The primary protein encoded by HTN3 is histatin 3. Histatins are a family of small, histidine-rich, salivary proteins, encoded by at least two loci (HTN3 and HTN1). Post-translational proteolyitic processing results in many histatins: e.g., histatins 4-6 are derived from histatin 3 by proteolysis. Histatins are believed to have important non-immunological, anti-microbial function in the oral cavity. [provided by RefSeq]

Alternate Names

Basic histidine-rich protein, HIS2histatin 5, histatin 3, histatin-3, Histidine-rich protein 3, hst, HTN2, HTN5, PB

Entrez Gene IDs

3347 (Human)

Gene Symbol

HTN3

UniProt

AAH09791 (Human)

Additional Histatin 3 Products

Product Documents for Histatin 3 Antibody (4G9) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Histatin 3 Antibody (4G9) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Histatin 3 Antibody (4G9) - Azide and BSA Free

Customer Reviews for Histatin 3 Antibody (4G9) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Histatin 3 Antibody (4G9) - Azide and BSA Free and earn rewards!

Have you used Histatin 3 Antibody (4G9) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies