Histone H2AY/macroH2A.1 Antibody (4D2O4)

Novus Biologicals | Catalog # NBP3-16743

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4D2O4 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Histone H2AY/macroH2A.1 (O75367). IHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLAL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Histone H2AY/macroH2A.1 Antibody (4D2O4)

Western Blot: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743]

Western Blot: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743]

Western Blot: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] - Western blot analysis of extracts of various cell lines, using Histone H2AY/macroH2A.1 Rabbit mAb (NBP3-16743) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743]

Immunocytochemistry/ Immunofluorescence: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743]

Immunocytochemistry/Immunofluorescence: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] - Immunofluorescence analysis of U-2 OS cells using Histone H2AY/macroH2A.1 Rabbit mAb (NBP3-16743) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/ Immunofluorescence: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743]

Immunocytochemistry/ Immunofluorescence: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743]

Immunocytochemistry/Immunofluorescence: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] - Immunofluorescence analysis of C6 cells using Histone H2AY/macroH2A.1 Rabbit mAb (NBP3-16743) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Histone H2AY/macroH2A.1 Antibody (4D2O4)

Immunohistochemistry: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] -

Immunohistochemistry: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] - Immunohistochemistry analysis of Histone H2AY/macroH2A.1 in paraffin-embedded rat testis tissue using Histone H2AY/macroH2A.1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Histone H2AY/macroH2A.1 Antibody (4D2O4)

Immunohistochemistry: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] -

Immunohistochemistry: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] - Immunohistochemistry analysis of Histone H2AY/macroH2A.1 in paraffin-embedded human colon tissue using Histone H2AY/macroH2A.1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Histone H2AY/macroH2A.1 Antibody (4D2O4)

Immunohistochemistry: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] -

Immunohistochemistry: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] - Immunohistochemistry analysis of Histone H2AY/macroH2A.1 in paraffin-embedded human breast cancer tissue using Histone H2AY/macroH2A.1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Histone H2AY/macroH2A.1 Antibody (4D2O4)

Immunohistochemistry: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] -

Immunohistochemistry: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] - Immunohistochemistry analysis of Histone H2AY/macroH2A.1 in paraffin-embedded mouse colon tissue using Histone H2AY/macroH2A.1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Histone H2AY/macroH2A.1 Antibody (4D2O4)

Immunohistochemistry: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] -

Immunohistochemistry: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] - Immunohistochemistry analysis of Histone H2AY/macroH2A.1 in paraffin-embedded human esophagus tissue using Histone H2AY/macroH2A.1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Histone H2AY/macroH2A.1 Antibody (4D2O4)

Immunohistochemistry: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] -

Immunohistochemistry: Histone H2AY/macroH2A.1 Antibody (4D2O4) [NBP3-16743] - Immunohistochemistry analysis of Histone H2AY/macroH2A.1 in paraffin-embedded human liver tissue using Histone H2AY/macroH2A.1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for Histone H2AY/macroH2A.1 Antibody (4D2O4)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Histone H2AY

macroH2A.1 (H2AFY) is 372 amino acids long, weighs approximately 40 kDa, and is part of a group of basic nuclear proteins called histones, which are responsible for nucleosome structure of the chromosomal fiber in eukaryotes. macroH2a.1 has two shorter isoforms meeasuring 371 and 369 amino acids long, both weighing approximately 39 kDa. Current studies are being done on several diseases and disorders including medulloblastoma, lupus erythematosus, Huntington's disease, immunodeficiency, melanoma, and malaria. macroH2A.1 has also been shown to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4E in pathways such as the chromatin regulation/ acetylation, systemic lupus erythematosus, and ATF-2 transcription factor pathways.

Long Name

H2A Histone Family, Member Y

Alternate Names

H2AF12M, H2AFJ, H2AFY, Histone MacroH2A1, Medulloblastoma Antigen MU-MB-50.205

Gene Symbol

MACROH2A1

Additional Histone H2AY Products

Product Documents for Histone H2AY/macroH2A.1 Antibody (4D2O4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Histone H2AY/macroH2A.1 Antibody (4D2O4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Histone H2AY/macroH2A.1 Antibody (4D2O4)

There are currently no reviews for this product. Be the first to review Histone H2AY/macroH2A.1 Antibody (4D2O4) and earn rewards!

Have you used Histone H2AY/macroH2A.1 Antibody (4D2O4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...