HLA DQA1 Antibody (7W0M7)

Novus Biologicals | Catalog # NBP3-15364

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7W0M7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 155-254 of human HLA DQA1 (P01909). EGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HLA DQA1 Antibody (7W0M7)

Western Blot: HLA DQA1 Antibody (7W0M7) [NBP3-15364]

Western Blot: HLA DQA1 Antibody (7W0M7) [NBP3-15364]

Western Blot: HLA DQA1 Antibody (7W0M7) [NBP3-15364] - Western blot analysis of extracts of various cell lines, using HLA DQA1 Rabbit mAb (NBP3-15364) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody (7W0M7) [NBP3-15364]

Immunohistochemistry-Paraffin: HLA DQA1 Antibody (7W0M7) [NBP3-15364]

Immunohistochemistry-Paraffin: HLA DQA1 Antibody (7W0M7) [NBP3-15364] - Immunohistochemistry of paraffin-embedded mouse spleen using HLA DQA1 Rabbit mAb (NBP3-15364) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody (7W0M7) [NBP3-15364]

Immunohistochemistry-Paraffin: HLA DQA1 Antibody (7W0M7) [NBP3-15364]

Immunohistochemistry-Paraffin: HLA DQA1 Antibody (7W0M7) [NBP3-15364] - Immunohistochemistry of paraffin-embedded rat spleen using HLA DQA1 Rabbit mAb (NBP3-15364) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: HLA DQA1 Antibody (7W0M7) [NBP3-15364]

Immunohistochemistry-Paraffin: HLA DQA1 Antibody (7W0M7) [NBP3-15364]

Immunohistochemistry-Paraffin: HLA DQA1 Antibody (7W0M7) [NBP3-15364] - Immunohistochemistry of paraffin-embedded human spleen using HLA DQA1 Rabbit mAb (NBP3-15364) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
HLA DQA1 Antibody (7W0M7)

Immunohistochemistry: HLA DQA1 Antibody (7W0M7) [HLA DQA1] -

Immunohistochemistry: HLA DQA1 Antibody (7W0M7) [HLA DQA1] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using HLA DQA1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HLA DQA1 Antibody (7W0M7)

Immunohistochemistry: HLA DQA1 Antibody (7W0M7) [HLA DQA1] -

Immunohistochemistry: HLA DQA1 Antibody (7W0M7) [HLA DQA1] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using HLA DQA1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HLA DQA1 Antibody (7W0M7)

Immunohistochemistry: HLA DQA1 Antibody (7W0M7) [HLA DQA1] -

Immunohistochemistry: HLA DQA1 Antibody (7W0M7) [HLA DQA1] - Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using HLA DQA1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HLA DQA1 Antibody (7W0M7)

Immunohistochemistry: HLA DQA1 Antibody (7W0M7) [HLA DQA1] -

Immunohistochemistry: HLA DQA1 Antibody (7W0M7) [HLA DQA1] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using HLA DQA1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HLA DQA1 Antibody (7W0M7)

Immunohistochemistry: HLA DQA1 Antibody (7W0M7) [HLA DQA1] -

Immunohistochemistry: HLA DQA1 Antibody (7W0M7) [HLA DQA1] - Immunohistochemistry analysis of paraffin-embedded Human colon tissue using HLA DQA1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
HLA DQA1 Antibody (7W0M7)

Immunohistochemistry: HLA DQA1 Antibody (7W0M7) [HLA DQA1] -

Immunohistochemistry: HLA DQA1 Antibody (7W0M7) [HLA DQA1] - Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using HLA DQA1 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Applications for HLA DQA1 Antibody (7W0M7)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL.

Immunohistochemistry

1:200 - 1:2000

Immunohistochemistry-Paraffin

1:200 - 1:2000

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HLA DQA1

HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. [provided by RefSeq]

Alternate Names

CD, CELIAC1DQ alpha 1 chain, DC-1 alpha chain, DQ-A1, FLJ27088, FLJ27328, GSE, HLA class II histocompatibility antigen, DQ(W3) alpha chain, HLA-DCA, HLA-DQA, leucocyte antigen DQA1, leukocyte antigen alpha chain, major histocompatibility complex, class II, DQ alpha 1, MGC149527, MHC class II antigen, MHC class II DQA1, MHC class II HLA-D alpha glycoprotein, MHC class II HLA-DQ-alpha-1, MHC class II surface glycoprotein, MHC HLA-DQ alpha

Gene Symbol

HLA-DQA1

Additional HLA DQA1 Products

Product Documents for HLA DQA1 Antibody (7W0M7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HLA DQA1 Antibody (7W0M7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HLA DQA1 Antibody (7W0M7)

There are currently no reviews for this product. Be the first to review HLA DQA1 Antibody (7W0M7) and earn rewards!

Have you used HLA DQA1 Antibody (7W0M7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...