hnRNP L Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38675

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for hnRNP L Antibody - BSA Free

Western Blot: hnRNP L Antibody [NBP2-38675]

Western Blot: hnRNP L Antibody [NBP2-38675]

Western Blot: hnRNP L Antibody [NBP2-38675] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: hnRNP L Antibody [NBP2-38675]

Immunocytochemistry/ Immunofluorescence: hnRNP L Antibody [NBP2-38675]

Immunocytochemistry/Immunofluorescence: hnRNP L Antibody [NBP2-38675] - Staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: hnRNP L Antibody [NBP2-38675]

Immunohistochemistry-Paraffin: hnRNP L Antibody [NBP2-38675]

Immunohistochemistry-Paraffin: hnRNP L Antibody [NBP2-38675] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Applications for hnRNP L Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: hnRNP L

Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (HNRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with HNRNP complexes and along with other HNRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA. Heterogeneous nuclear ribonucleoprotein L is present in the nucleoplasm as part of the HNRP complex. HNRP proteins have also been identified outside of the nucleoplasm. Exchange of HNRNP for mRNA-binding proteins accompanies transport of mRNA from the nucleus to the cytoplasm. Since HNRP proteins have been shown to shuttle between the nucleus and the cytoplasm, it is possible that they also have cytoplasmic functions.Strucutrally, hnRPL contains 2 segments of approximately 80 amino acids each which are weakly related to each other and to the ribonucleoprotein consensus sequence-type RNA-binding domains of other HNRNP and snRNP proteins.

Alternate Names

FLJ35509, heterogeneous nuclear ribonucleoprotein L, hnRNP L, hnRNP-L, HNRPL

Gene Symbol

HNRNPL

UniProt

Additional hnRNP L Products

Product Documents for hnRNP L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for hnRNP L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for hnRNP L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review hnRNP L Antibody - BSA Free and earn rewards!

Have you used hnRNP L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...