hnRNP-Q Antibody (1R0G5)

Novus Biologicals | Catalog # NBP3-16838

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1R0G5 expressed in HEK293
View all hnRNP-Q Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 524-623 of human hnRNP-Q (O60506). SQRGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGNVGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTFGQQWK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for hnRNP-Q Antibody (1R0G5)

Western Blot: hnRNP-Q Antibody (1R0G5) [NBP3-16838]

Western Blot: hnRNP-Q Antibody (1R0G5) [NBP3-16838]

Western Blot: hnRNP-Q Antibody (1R0G5) [NBP3-16838] - Western blot analysis of extracts of various cell lines, using hnRNP-Q /SYNCRIP Rabbit mAb (NBP3-16838) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.
Immunohistochemistry-Paraffin: hnRNP-Q Antibody (1R0G5) [NBP3-16838]

Immunohistochemistry-Paraffin: hnRNP-Q Antibody (1R0G5) [NBP3-16838]

Immunohistochemistry-Paraffin: hnRNP-Q Antibody (1R0G5) [NBP3-16838] - Immunohistochemistry of paraffin-embedded mouse brain using hnRNP-Q /SYNCRIP Rabbit mAb (NBP3-16838) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: hnRNP-Q Antibody (1R0G5) [NBP3-16838]

Immunohistochemistry-Paraffin: hnRNP-Q Antibody (1R0G5) [NBP3-16838]

Immunohistochemistry-Paraffin: hnRNP-Q Antibody (1R0G5) [NBP3-16838] - Immunohistochemistry of paraffin-embedded human liver cancer using hnRNP-Q /SYNCRIP Rabbit mAb (NBP3-16838) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
hnRNP-Q Antibody (1R0G5)

Immunocytochemistry/ Immunofluorescence: hnRNP-Q Antibody (1R0G5) [NBP3-16838] -

Immunocytochemistry/ Immunofluorescence: hnRNP-Q Antibody (1R0G5) [NBP3-16838] - Confocal imaging of NIH/3T3 cells using hnRNP-Q Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
hnRNP-Q Antibody (1R0G5)

Immunocytochemistry/ Immunofluorescence: hnRNP-Q Antibody (1R0G5) [NBP3-16838] -

Immunocytochemistry/ Immunofluorescence: hnRNP-Q Antibody (1R0G5) [NBP3-16838] - Confocal imaging of HeLa cells using hnRNP-Q Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for hnRNP-Q Antibody (1R0G5)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: hnRNP-Q

Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. Component of the CRD-mediated complex that promotes MYC mRNA stability. Isoform 1, isoform 2 and isoform 3 are associated in vitro with pre-mRNA, splicing intermediates and mature mRNA protein complexes. Isoform 1 binds to apoB mRNA AU-rich sequences. Isoform 1 is part of the APOB mRNA editosome complex and may modulate the postranscriptional C to U RNA-editing of the APOB mRNA through either by binding to A1CF (APOBEC1 complementation factor), to APOBEC1 or to RNA itself. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Interacts in vitro preferentially with poly(A) and poly(U) RNA sequences. Isoform 3 may be involved in cytoplasmic vesicle-based mRNA transport through interaction with synaptotagmins

Alternate Names

dJ3J17.2, Glycine- and tyrosine-rich RNA-binding protein, GRYRBP, GRY-RBPNS1-associated protein 1, heterogeneous nuclear ribonucleoprotein Q, hnRNP Q, hnRNP-Q, HNRPQ, HNRPQ1, NSAP1FLJ31626, PP68, synaptotagmin binding, cytoplasmic RNA interacting protein, Synaptotagmin-binding, cytoplasmic RNA-interacting protein

Gene Symbol

SYNCRIP

Additional hnRNP-Q Products

Product Documents for hnRNP-Q Antibody (1R0G5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for hnRNP-Q Antibody (1R0G5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for hnRNP-Q Antibody (1R0G5)

There are currently no reviews for this product. Be the first to review hnRNP-Q Antibody (1R0G5) and earn rewards!

Have you used hnRNP-Q Antibody (1R0G5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies