HNRNPA0 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57275

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to HNRPA0 (heterogeneous nuclear ribonucleoprotein A0) The peptide sequence was selected from the middle region of HNRPA0. Peptide sequence KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for HNRNPA0 Antibody - BSA Free

Western Blot: HNRNPA0 Antibody [NBP1-57275]

Western Blot: HNRNPA0 Antibody [NBP1-57275]

Western Blot: HNRNPA0 Antibody [NBP1-57275] - Amount and Lane 1 : 5% Input Lane 2: 5% Sup Lane 3: Normal IgG Lane 4: hn-RNPA0 ppt. k562 Sample IP Antibody: HNRPA0 Amount of IP Antibody: Primary Antibody: HNRPA0 Primary Antibody Dilution: 1 : 4000 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody
Immunocytochemistry/ Immunofluorescence: HNRNPA0 Antibody [NBP1-57275]

Immunocytochemistry/ Immunofluorescence: HNRNPA0 Antibody [NBP1-57275]

Immunocytochemistry/Immunofluorescence: HNRNPA0 Antibody [NBP1-57275] - MCF7 cells Primary Antibody Dilution : 1:200 Secondary Antibody: Anti-rabbit-FITC Secondary Antibody Dilution: 1:500 Color/Signal Descriptions: DAPI: Blue hn-RNPA0: Green Gene Name: HNRPA0
Immunohistochemistry: HNRNPA0 Antibody [NBP1-57275]

Immunohistochemistry: HNRNPA0 Antibody [NBP1-57275]

Immunohistochemistry: HNRNPA0 Antibody [NBP1-57275] - Human cardiac cell Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
Western Blot: HNRNPA0 Antibody [NBP1-57275]

Western Blot: HNRNPA0 Antibody [NBP1-57275]

Western Blot: HNRNPA0 Antibody [NBP1-57275] - Jurkat cell lysate, Antibody Titration: 0.625ug/ml
Western Blot: HNRNPA0 Antibody [NBP1-57275]

Western Blot: HNRNPA0 Antibody [NBP1-57275]

Western Blot: HNRNPA0 Antibody [NBP1-57275] - Lanes: Lane 1 : 20 ug HeLa S3 lysate Lane 2: 20 ug MCF7 lysate Lane 3: 20 ug K562 lysate Primary, Antibody Dilution: 1 : 4000 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: HNRPA0.
Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-57275]

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-57275]

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-57275] - Human Heart Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Myocardial cells (indicated with arrows) 400X magnification.
Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-57275]

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-57275]

Immunohistochemistry-Paraffin: HNRNPA0 Antibody [NBP1-57275] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.

Applications for HNRNPA0 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Immunoprecipitation

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HNRNPA0

HNRPA0 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus.

Alternate Names

heterogeneous nuclear ribonucleoprotein A0, hnRNA binding protein, hnRNPA0, HNRPA0hnRNP A0

Gene Symbol

HNRNPA0

UniProt

Additional HNRNPA0 Products

Product Documents for HNRNPA0 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HNRNPA0 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HNRNPA0 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HNRNPA0 Antibody - BSA Free and earn rewards!

Have you used HNRNPA0 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...