HOXA11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83233

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Rat

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Flow Cytometry

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HOXA11 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HOXA11 Antibody - BSA Free

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233]

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233]

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233]

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233]

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233] - Analysis in human endometrium and cerebral cortex tissues. Corresponding HOXA11 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233]

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233]

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233] - Staining of human tonsil shows no positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233]

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233]

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233] - Staining of human testis shows weak nuclear positivity in a subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233]

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233]

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233] - Staining of human endometrium shows moderate to strong nuclear positivity in cells in endometrial stroma.
HOXA11 Antibody - BSA Free Western Blot: HOXA11 Antibody - BSA Free [NBP1-83233]

Western Blot: HOXA11 Antibody - BSA Free [NBP1-83233]

Analysis in control (vector only transfected HEK293T lysate) and HOXA11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for HOXA11 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXA11

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is involved in the regulation of uterine development and is required for female fertility. Mutations in this gene can cause radio-ulnar synostosis with amegakaryocytic thrombocytopenia.

Alternate Names

homeo box A11, homeobox A11, Homeobox protein Hox-1I, homeobox protein HOXA11, homeobox protein Hox-A11, HOX1, HOX1Ihomeo box 1I

Gene Symbol

HOXA11

Additional HOXA11 Products

Product Documents for HOXA11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HOXA11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HOXA11 Antibody - BSA Free

Customer Reviews for HOXA11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXA11 Antibody - BSA Free and earn rewards!

Have you used HOXA11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies