HOXA4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-32515

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NTKMRSSNSASASAGPPGKAQTQSPHLHPHPHPSTSTPVPSSI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HOXA4 Antibody - BSA Free

Western Blot: HOXA4 Antibody [NBP2-32515]

Western Blot: HOXA4 Antibody [NBP2-32515]

Western Blot: HOXA4 Antibody [NBP2-32515] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: HOXA4 Antibody [NBP2-32515]

Immunocytochemistry/ Immunofluorescence: HOXA4 Antibody [NBP2-32515]

Immunocytochemistry/Immunofluorescence: HOXA4 Antibody [NBP2-32515] - Immunofluorescent staining of human cell line HEK 293 shows localization to nuclear bodies.
Immunohistochemistry-Paraffin: HOXA4 Antibody [NBP2-32515]

Immunohistochemistry-Paraffin: HOXA4 Antibody [NBP2-32515]

Immunohistochemistry-Paraffin: HOXA4 Antibody [NBP2-32515] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.

Applications for HOXA4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: HOXA4

HOXA4 is 320 amino acids long, weighing approximately 46 kDa, that functions as a sequence-specific transcription factor which focuses on the specific positional identities of cells on the anterior-posterior axis, which is all part of a developmental regulatory system, specifically the embryonic nervous system. Current studies are being done on several diseases and disorders including abdominal aortic aneuryms, megacolon, myeloid leukemia, Hirschsprung's disease, hypospadias, teratocarcinoma, ovarian cancer, neuroblastoma, and pancreatitis. HOXA4 has also been shown to have interactions with NFE2.

Alternate Names

homeo box A4, homeobox A4, Homeobox protein Hox-1.4, Homeobox protein Hox-1D, homeobox protein Hox-A4, HOX1, Hox-1.4-like protein, HOX1DDfd-like protein

Gene Symbol

HOXA4

Additional HOXA4 Products

Product Documents for HOXA4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for HOXA4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for HOXA4 Antibody - BSA Free

Customer Reviews for HOXA4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HOXA4 Antibody - BSA Free and earn rewards!

Have you used HOXA4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...