HSP20/HSPB6 Antibody (3J5N1)

Novus Biologicals | Catalog # NBP3-16751

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 3J5N1 expressed in HEK293
View all HSP20/HSPB6 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-150 of human HSP20/HSPB6 (O14558). DPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for HSP20/HSPB6 Antibody (3J5N1)

Western Blot: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751]

Western Blot: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751]

Western Blot: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Western blot analysis of extracts of various cell lines, using HSP20/HSPB6 Rabbit mAb (NBP3-16751) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
HSP20/HSPB6 Antibody (3J5N1)

Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] -

Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Immunohistochemistry analysis of HSP20/HSPB6 in paraffin-embedded human colon carcinoma tissue using HSP20/HSPB6 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
HSP20/HSPB6 Antibody (3J5N1)

Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] -

Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Immunohistochemistry analysis of HSP20/HSPB6 in paraffin-embedded rat heart tissue using HSP20/HSPB6 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
HSP20/HSPB6 Antibody (3J5N1)

Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] -

Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Immunohistochemistry analysis of HSP20/HSPB6 in paraffin-embedded human lung tissue using HSP20/HSPB6 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
HSP20/HSPB6 Antibody (3J5N1)

Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] -

Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Immunohistochemistry analysis of HSP20/HSPB6 in paraffin-embedded mouse heart tissue using HSP20/HSPB6 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
HSP20/HSPB6 Antibody (3J5N1)

Immunocytochemistry/ Immunofluorescence: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] -

Immunocytochemistry/ Immunofluorescence: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Confocal imaging of paraffin-embedded Rat heart tissue using HSP20/HSPB6 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
HSP20/HSPB6 Antibody (3J5N1)

Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] -

Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Immunohistochemistry analysis of HSP20/HSPB6 in paraffin-embedded human liver cancer tissue using HSP20/HSPB6 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
HSP20/HSPB6 Antibody (3J5N1)

Immunocytochemistry/ Immunofluorescence: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] -

Immunocytochemistry/ Immunofluorescence: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Confocal imaging of paraffin-embedded Mouse heart tissue using HSP20/HSPB6 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
HSP20/HSPB6 Antibody (3J5N1)

Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] -

Immunohistochemistry: HSP20/HSPB6 Antibody (3J5N1) [NBP3-16751] - Immunohistochemistry analysis of HSP20/HSPB6 in paraffin-embedded rat colon tissue using HSP20/HSPB6 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Applications for HSP20/HSPB6 Antibody (3J5N1)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HSP20/HSPB6

Hsp20 is a small heat shock protein related to Hsp25, Hsp27 and may form different hetercomplexes with these proteins. The specific physiological function of Hsp20 is not yet known. It is distributed ubiquitously in tissues, but is found in higher levels in skeletal, smooth and heart muscle. Under normal conditions, Hsp20 is diffusely distributed in the cytosol, but under heat stress conditions, it translocates to the nucleus. Unlike other heat shock proteins the amount of Hsp20 does not increase after heat shock. The Hsp20 was demonstrated to constitute up to 1.3% of the total cellular protein in vertebrate tissues, especially in muscle, and its expression is related to muscle contraction, specifically in slow-twitch muscle. Hsp20 may form different heterocomplexes with other Hsp's, such as alpha-crystalline and Hsp25. Phosphorylated form of Hsp20 is proposed to interact with monomeric actin whereas dephosphorylated form binds polymeric actin filaments. In normal conditions Hsp20 is diffusely disturbed in cytosol but under the heat stress it undergoes translocation to membrane fraction.

Long Name

Heat Shock Protein 20

Alternate Names

HSPB6

Gene Symbol

HSPB6

Additional HSP20/HSPB6 Products

Product Documents for HSP20/HSPB6 Antibody (3J5N1)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HSP20/HSPB6 Antibody (3J5N1)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HSP20/HSPB6 Antibody (3J5N1)

There are currently no reviews for this product. Be the first to review HSP20/HSPB6 Antibody (3J5N1) and earn rewards!

Have you used HSP20/HSPB6 Antibody (3J5N1)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies