HspA4L Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35770

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all HspA4L Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 500-600 of human HspA4L (NP_055093.2).

Sequence:
KQNLEGDHSDAPMETETSFKNENKDNMDKMQVDQEEGHQKCHAEHTPEEEIDHTGAKTKSAVSDKQDRLNQTLKKGKVKSIDLPIQSSLCRQLGQDLLNSY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for HspA4L Antibody - BSA Free

HspA4L Antibody

Immunocytochemistry/ Immunofluorescence: HspA4L Antibody [NBP3-35770] -

Immunocytochemistry/ Immunofluorescence: HspA4L Antibody [NBP3-35770] - Immunofluorescence analysis of A431 cells using HspA4L Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
HspA4L Antibody

Western Blot: HspA4L Antibody [NBP3-35770] -

Western Blot: HspA4L Antibody [NBP3-35770] - Western blot analysis of various lysates using HspA4L Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 5s.

Applications for HspA4L Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: HspA4L

HSPA4L is a novel autocrine pathway of CD1d regulation by Hsp110.

Alternate Names

APG1, APG-1, heat shock 70 kDa protein 4L, heat shock 70 kDa protein 4-like protein, heat shock 70kDa protein 4-like, Heat shock 70-related protein APG-1, heat shock protein (hsp110 family), Osmotic stress protein 94, OSP94

Gene Symbol

HSPA4L

Additional HspA4L Products

Product Documents for HspA4L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for HspA4L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for HspA4L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review HspA4L Antibody - BSA Free and earn rewards!

Have you used HspA4L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies