HSPC111 Antibody - Azide and BSA Free
Novus Biologicals | Catalog # H00051491-B01P
![Western Blot: HSPC111 Antibody [H00051491-B01P]](https://resources.rndsystems.com/images/products/HSPC111-Antibody-Western-Blot-H00051491-B01P-img0010.jpg "Western Blot: HSPC111 Antibody [H00051491-B01P]")
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Mouse IgG
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
HSPC111 (AAH40106.1, 1 a.a. - 178 a.a.) full-length human protein. MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE
Specificity
HSPC111 - hypothetical protein HSPC111,
Clonality
Polyclonal
Host
Mouse
Isotype
IgG
Scientific Data Images for HSPC111 Antibody - Azide and BSA Free
Western Blot: HSPC111 Antibody [H00051491-B01P]
Western Blot: HSPC111 Antibody [H00051491-B01P] - Analysis of HSPC111 expression in NIH/3T3.![Immunocytochemistry/ Immunofluorescence: HSPC111 Antibody [H00051491-B01P]](https://resources.rndsystems.com/images/products/HSPC111-Antibody-Immunocytochemistry-Immunofluorescence-H00051491-B01P-img0005.jpg "Immunocytochemistry/ Immunofluorescence: HSPC111 Antibody [H00051491-B01P]")
Immunocytochemistry/ Immunofluorescence: HSPC111 Antibody [H00051491-B01P]
Immunocytochemistry/Immunofluorescence: HSPC111 Antibody [H00051491-B01P] - Analysis of purified antibody to HSPC111 on HeLa cell. (antibody concentration 10 ug/ml)![Immunohistochemistry-Paraffin: HSPC111 Antibody [H00051491-B01P]](https://resources.rndsystems.com/images/products/HSPC111-Antibody-Immunohistochemistry-Paraffin-H00051491-B01P-img0006.jpg "Immunohistochemistry-Paraffin: HSPC111 Antibody [H00051491-B01P]")
Immunohistochemistry-Paraffin: HSPC111 Antibody [H00051491-B01P]
Immunohistochemistry-Paraffin: HSPC111 Antibody [H00051491-B01P] - Analysis of purified antibody to HSPC111 on formalin-fixed paraffin-embedded human esophagus. (antibody concentration 3 ug/ml)![Western Blot: HSPC111 Antibody [H00051491-B01P]](https://resources.rndsystems.com/images/products/HSPC111-Antibody-Western-Blot-H00051491-B01P-img0007.jpg "Western Blot: HSPC111 Antibody [H00051491-B01P]")
Western Blot: HSPC111 Antibody [H00051491-B01P]
Western Blot: HSPC111 Antibody [H00051491-B01P] - Analysis of HSPC111 expression in HeLa.![Western Blot: HSPC111 Antibody [H00051491-B01P]](https://resources.rndsystems.com/images/products/HSPC111-Antibody-Western-Blot-H00051491-B01P-img0008.jpg "Western Blot: HSPC111 Antibody [H00051491-B01P]")
Western Blot: HSPC111 Antibody [H00051491-B01P]
Western Blot: HSPC111 Antibody [H00051491-B01P] - Analysis of NOP16 expression in PC-12.![Western Blot: HSPC111 Antibody [H00051491-B01P]](https://resources.rndsystems.com/images/products/HSPC111-Antibody-Western-Blot-H00051491-B01P-img0009.jpg "Western Blot: HSPC111 Antibody [H00051491-B01P]")
Western Blot: HSPC111 Antibody [H00051491-B01P]
Western Blot: HSPC111 Antibody [H00051491-B01P] - Analysis of NOP16 expression in Raw 264.7.![Western Blot: HSPC111 Antibody [H00051491-B01P]](https://resources.rndsystems.com/images/products/HSPC111-Antibody-Western-Blot-H00051491-B01P-img0011.jpg "Western Blot: HSPC111 Antibody [H00051491-B01P]")
Western Blot: HSPC111 Antibody [H00051491-B01P]
Western Blot: HSPC111 Antibody [H00051491-B01P] - Analysis of NOP16 expression in transfected 293T cell line by NOP16 polyclonal antibody. Lane 1: HSPC111 transfected lysate(19.58 KDa). Lane 2: Non-transfected lysate.Applications for HSPC111 Antibody - Azide and BSA Free
Application
Recommended Usage
Western Blot
1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. May also be used for immunofluorescence, immunohistochemistry (paraffin).
Formulation, Preparation, and Storage
Purification
Protein A purified
Formulation
PBS (pH 7.4)
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: HSPC111
Alternate Names
HBV pre-S2 trans-regulated protein 3, HSPC111HSPC185, LOC51491, NOP15, NOP16 nucleolar protein homolog (yeast), nucleolar protein 16, nucleolar protein 16 homolog, nucleolar protein 16 homolog (yeast)
Entrez Gene IDs
51491 (Human)
Gene Symbol
NOP16
UniProt
Additional HSPC111 Products
Product Documents for HSPC111 Antibody - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for HSPC111 Antibody - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for HSPC111 Antibody - Azide and BSA Free
There are currently no reviews for this product. Be the first to review HSPC111 Antibody - Azide and BSA Free and earn rewards!
Have you used HSPC111 Antibody - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...