Human Ubiquitin Antibody (83406)

R&D Systems | Catalog # A-104

Product is in the process of being discontinued.
R&D Systems
Discontinued Product
A-104 has been discontinued. View all Ubiquitin products.

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Applications

Validated:

Western Blot

Cited:

Western Blot, Immunoprecipitation, Bioassay

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2B Clone # 83406
Loading...

Product Specifications

Immunogen

Human Ubiquitin+1 synthetic peptide
SSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQ LEDGRTLSDYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGSGAQ

Specificity

This antibody detects human Ubiquitin and Ubiquitin+1 in Western blots.

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2B

Scientific Data Images for Human Ubiquitin Antibody (83406)

Detection of Human Ubiquitin antibody by Western Blot.

Detection of Human Ubiquitin by Western Blot.

Western blot shows lysates of HCT-116 human colorectal carcinoma cell line. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human Ubiquitin Monoclonal Antibody (Catalog # A-104) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). Specific bands were detected for Ubiquitin at approximately 5-10 & 37-250 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Applications for Human Ubiquitin Antibody (83406)

Application
Recommended Usage

Western Blot

0.1-0.5 µg/mL
Sample: HCT‑116 human colorectal carcinoma cell line

Formulation, Preparation, and Storage

Purification

Protein A or G purified from hybridoma culture supernatant

Formulation

Supplied as a solution in PBS containing Glycerol and Sodium Azide.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store the unopened product at -20 °C. Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Storage below -20 °C is not recommended. Do not use past expiration date.

Background: Ubiquitin

Ubiquitin is a 76 amino acid (aa) protein that is ubiquitously expressed in all eukaryotic organisms. Ubiquitin is highly conserved with 96% aa sequence identity shared between human and yeast. In mammals, four ubiquitin genes encode for two ubiquitin­ribosomal fusion proteins and two polyubiquitin proteins. Cleavage of the ubiquitin precursors by deubiquitinating enzymes gives rise to identical ubiquitin monomers each with a predicted molecular weight of 8.6 kDa. Conjugation of ubiquitin to target proteins involves the formation of an isopeptide bond between the C­terminal glycine residue of ubiquitin and a lysine residue in the target protein. This process of conjugation, referred to as ubiquitination or ubiquitylation, is a multi­step process that requires three enzymes: a ubiquitin­activating (E1) enzyme, a ubiquitin­conjugating (E2) enzyme, and a ubiquitin ligase (E3). Ubiquitination is classically recognized as a mechanism to target proteins for degradation and as a result, ubiquitin was originally named ATP­dependent Proteolysis Factor 1 (APF­1). In addition to protein degradation, ubiquitination has been shown to mediate a variety of biological processes such as signal transduction, endocytosis, and post­endocytic sorting.

References


Alternate Names

UBB

Entrez Gene IDs

7314 (Human); 298693 (Rat)

Gene Symbol

UBB

Additional Ubiquitin Products

Product Documents for Human Ubiquitin Antibody (83406)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Note: Certificate of Analysis not available for kit components.

Product Specific Notices for Human Ubiquitin Antibody (83406)

* Contains <0.1% Sodium Azide, which is not hazardous at this concentration according to GHS classifications. Refer to SDS for additional information and handling instructions.

For research use only

Citations for Human Ubiquitin Antibody (83406)

Customer Reviews for Human Ubiquitin Antibody (83406)

There are currently no reviews for this product. Be the first to review Human Ubiquitin Antibody (83406) and earn rewards!

Have you used Human Ubiquitin Antibody (83406)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...