Hyaluronan Synthase 3/HAS3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35352

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 67-281 of human Hyaluronan Synthase 3/HAS3 (NP_619515.1).

Sequence:
HRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Hyaluronan Synthase 3/HAS3 Antibody - BSA Free

Hyaluronan Synthase 3/HAS3 Antibody

Western Blot: Hyaluronan Synthase 3/HAS3 Antibody [NBP3-35352] -

Western Blot: Hyaluronan Synthase 3/HAS3 Antibody [NBP3-35352] - Western blot analysis of various lysates using Hyaluronan Synthase 3/HAS3 Rabbit pAb at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
Hyaluronan Synthase 3/HAS3 Antibody

Immunocytochemistry/ Immunofluorescence: Hyaluronan Synthase 3/HAS3 Antibody [NBP3-35352] -

Immunocytochemistry/ Immunofluorescence: Hyaluronan Synthase 3/HAS3 Antibody [NBP3-35352] - Immunofluorescence analysis of A549 cells using Hyaluronan Synthase 3/HAS3 Rabbit pAb. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Hyaluronan Synthase 3/HAS3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:100 - 1:500

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Hyaluronan Synthase 3/HAS3

The protein encoded by the HAS3 gene is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, orhyaluronic acid, which is a major constituent of the extracellular matrix. This gene is a member of the NODC/HAS genefamily. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of aregulator of hyaluronan synthesis. Two transcript variants encoding different isoforms have been found for this gene.(provided by RefSeq)

Alternate Names

HAS3

Gene Symbol

HAS3

Additional Hyaluronan Synthase 3/HAS3 Products

Product Documents for Hyaluronan Synthase 3/HAS3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Hyaluronan Synthase 3/HAS3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Hyaluronan Synthase 3/HAS3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Hyaluronan Synthase 3/HAS3 Antibody - BSA Free and earn rewards!

Have you used Hyaluronan Synthase 3/HAS3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...