Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-14080
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: QHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVR
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%). Reactivity reported in scientific literature (PMID: 24648543). Canine reactivity reported from a verified customer review.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Analysis in human liver and endometrium tissues using NBP2-14080 antibody. Corresponding HAO1 RNA-seq data are presented for the same tissues.Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]
Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Analysis in human liver tissue.Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Hydroxyacid Oxidase-1/HAO-1 antibody was used on canine paraffin-embedded liver tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Tris/EDTA buffer for two hours at 75C. Image from verified customer review.Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human endometrium shows no positivity in glandular cells as expected.Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human liver shows strong granular cytoplasm positivity in hepatocytes.Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human testis shows moderate granular cytoplasm positivity in cells in seminiferous ducts.Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human prostate shows no positivity in glandular cells.Applications for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000-1:2500
Western Blot
0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 3 reviews rated 3.7 using NBP2-14080 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Hydroxyacid Oxidase-1/HAO-1
Alternate Names
GOX, HAO-1, HAO1, HAOX1, Hydroxyacid Oxidase1
Gene Symbol
HAO1
Additional Hydroxyacid Oxidase-1/HAO-1 Products
Product Documents for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free
Customer Reviews for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free (3)
3.7 out of 5
3 Customer Ratings
Have you used Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
3 of
3 reviews
Showing All
Filter By:
-
Application: Immunohistochemistry-ParaffinSample Tested: IHC Sample TestedSpecies: TurtleVerified Customer | Posted 05/11/2022HAO1 used at 1:50 on a snapping turtle liver. Hydroxyacid Oxidase-1/HAO-1 antibody was used on turtle paraffin-embedded liver tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Tris/EDTA buffer for two hours at 75C.
-
Application: Immunohistochemistry-ParaffinSample Tested: Liver tissueSpecies: CanineVerified Customer | Posted 03/11/2022HAO1 in Canine LiverHAO1 was used on canine paraffin-embedded liver tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Tris/EDTA buffer for two hours at 75C.Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
-
Application: Immunohistochemistry-ParaffinSample Tested: Liver tissueSpecies: MouseVerified Customer | Posted 07/01/2019HAO1 Mouse Liver StainingAverage Antibody when tested in Mouse Liver, has clear staining patterns, however has minor background noise within the tissue.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...