Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14080

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: QHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (88%). Reactivity reported in scientific literature (PMID: 24648543). Canine reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Analysis in human liver and endometrium tissues using NBP2-14080 antibody. Corresponding HAO1 RNA-seq data are presented for the same tissues.
Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Western Blot: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Analysis in human liver tissue.
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Hydroxyacid Oxidase-1/HAO-1 antibody was used on canine paraffin-embedded liver tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Tris/EDTA buffer for two hours at 75C. Image from verified customer review.
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human liver shows strong granular cytoplasm positivity in hepatocytes.
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human testis shows moderate granular cytoplasm positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080]

Immunohistochemistry-Paraffin: Hydroxyacid Oxidase-1/HAO-1 Antibody [NBP2-14080] - Staining of human prostate shows no positivity in glandular cells.

Applications for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000-1:2500

Western Blot

0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 3 reviews rated 3.7 using NBP2-14080 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Hydroxyacid Oxidase-1/HAO-1

HAO1 is one of three related genes that have 2-hydroxyacid oxidase activity yet differ in encoded protein amino acid sequence, tissue expression and substrate preference. Subcellular location of the encoded protein is the peroxisome. Specifically, this gene is expressed primarily in liver and pancreas and the encoded protein is most active on glycolate, a two-carbon substrate. The protein is also active on 2-hydroxy fatty acids. The transcript detected at high levels in pancreas may represent an alternatively spliced form or the use of a multiple near-consensus upstream polyadenylation site. [provided by RefSeq]

Alternate Names

GOX, HAO-1, HAO1, HAOX1, Hydroxyacid Oxidase1

Gene Symbol

HAO1

Additional Hydroxyacid Oxidase-1/HAO-1 Products

Product Documents for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free

Customer Reviews for Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free (3)

3.7 out of 5
3 Customer Ratings
5 Stars
33%
4 Stars
0%
3 Stars
67%
2 Stars
0%
1 Stars
0%

Have you used Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 3 of 3 reviews Showing All
Filter By:
  • Hydroxyacid Oxidase-1/HAO-1 Antibody
    Name: Vojtech Gabriel
    Application: Immunohistochemistry-Paraffin
    Sample Tested: IHC Sample Tested
    Species: Turtle
    Verified Customer | Posted 05/11/2022
    HAO1 used at 1:50 on a snapping turtle liver. Hydroxyacid Oxidase-1/HAO-1 antibody was used on turtle paraffin-embedded liver tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Tris/EDTA buffer for two hours at 75C.
    Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free NBP2-14080
  • Hydroxyacid Oxidase-1/HAO-1 Antibody
    Name: Hannah Wickham
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Liver tissue
    Species: Canine
    Verified Customer | Posted 03/11/2022
    HAO1 in Canine Liver
    HAO1 was used on canine paraffin-embedded liver tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Tris/EDTA buffer for two hours at 75C.
    Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free NBP2-14080
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
  • Hydroxyacid Oxidase-1/HAO-1 Antibody
    Name: Faye Doherty
    Application: Immunohistochemistry-Paraffin
    Sample Tested: Liver tissue
    Species: Mouse
    Verified Customer | Posted 07/01/2019
    HAO1 Mouse Liver Staining
    Average Antibody when tested in Mouse Liver, has clear staining patterns, however has minor background noise within the tissue.
    Hydroxyacid Oxidase-1/HAO-1 Antibody - BSA Free NBP2-14080

There are no reviews that match your criteria.

Showing  1 - 3 of 3 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...