Iberiotoxin

Catalog # Availability Size / Price Qty
1086/100U
Iberiotoxin
1 Image
Description: KCa (BK) channel blocker

Purity: ≥95%

Product Details
Citations (15)
Reviews

Biological Activity

Iberiotoxin is a selective blocker of the big conductance Ca2+-activated K+ channel.

Technical Data

M.Wt:
4230
Formula:
C179H274N50O55S7
Sequence:
XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ

(Modifications: X-1 = pGlu, Disulfide bridges: 7-28, 13-33, 17-35)

Solubility:
Soluble to 0.70 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
129203-60-7

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and CoA (available online).

Citations for Iberiotoxin

The citations listed below are publications that use Tocris products. Selected citations for Iberiotoxin include:

15 Citations: Showing 1 - 10

  1. BK Channels Localize to the Paranodal Junction and Regulate Action Potentials in Myelinated Axons of Cerebellar Purkinje Cells.
    Authors: Hirono Et al.
    Am J Physiol Cell Physiol  2015;35:7082
  2. The role of K+ and Cl- channels in the regulation of retinal arteriolar tone and blood flow.
    Authors: Needham Et al.
    FASEB J  2014;55:2157
  3. Maternal nutrient restriction during pregnancy impairs an endothelium-derived hyperpolarizing factor-like pathway in sheep fetal coronary arteries.
    Authors: Shukla Et al.
    Am J Physiol Heart Circ Physiol  2014;307:H134
  4. BK channels regulate sinoatrial node firing rate and cardiac pacing in vivo.
    Authors: Lai Et al.
    Am J Physiol Heart Circ Physiol  2014;307:H1327
  5. Bupivacaine-induced Vasodilation Is Mediated by Decreased Calcium Sensitization in Isolated Endothelium-denuded Rat Aortas Precontracted with Phenylephrine.
    Authors: Ok Et al.
    Korean J Pain  2014;27:229
  6. Quercetin acutely relaxes airway smooth muscle and potentiates β-agonist-induced relaxation via dual phosphodiesterase inhibition of PLCβ and PDE4.
    Authors: Townsend and Emala
    Am J Physiol Lung Cell Mol Physiol  2013;305:L396
  7. Mechanisms underlying activation of transient BK current in rabbit urethral smooth muscle cells and its modulation by IP3-generating agonists.
    Authors: Kyle Et al.
    Invest Ophthalmol Vis Sci  2013;305:C609
  8. Slo1 is the principal potassium channel of human spermatozoa.
    Authors: Mannowetz Et al.
    Elife (Cambridge)  2013;2:e01009
  9. Reduced vascular smooth muscle BK channel current underlies heart failure-induced vasoconstriction in mice.
    Authors: Wan Et al.
    Mol Pain  2013;27:1859
  10. The expression and relaxant effect of bitter taste receptors in human bronchi.
    Authors: Grassin-Delyle Et al.
    Respir Res  2013;14:134

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Iberiotoxin

There are currently no reviews for this product. Be the first to review Iberiotoxin and earn rewards!

Have you used Iberiotoxin?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.