Catalog Number: 1086
Biological Activity
Selective blocker of the big conductance Ca2+-activated K+ channel.
Technical Data
  • M.Wt:
    4230
  • Formula:
    C179H274N50O55S7
  • Sequence:
    XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ

    (Modifications: X-1 = pGlu, Disulfide bridge between 7 - 28,13 - 33,17 - 35)

  • Solubility:
    Soluble to 0.70 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    129203-60-7
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Background References
  1. Purification and characterization of a unique, potent, peptidyl probe for the high conductance calcium-activated potassium channel from venom of the scorpion Buthus tamulus.
    Galvez et al.
    J.Biol.Chem., 1990;265:11083
  2. Effects of charybdotoxin and iberiotoxin on the spontaneous motility and tonus of different guinea-pig smooth muscle tissues.
    Suarez-Kurtz et al.
    J.Pharmacol.Exp.Ther., 1991;259:439
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Iberiotoxin include:

9 Citations: Showing 1 - 9
Filter your results:

  1. BK Channels Localize to the Paranodal Junction and Regulate Action Potentials in Myelinated Axons of Cerebellar Purkinje Cells.
    Authors: Hirono Et al.
    Am J Physiol Cell Physiol 2015;35:7082
  2. The role of K+ and Cl- channels in the regulation of retinal arteriolar tone and blood flow.
    Authors: Needham Et al.
    FASEB J 2014;55:2157
  3. BK channels regulate sinoatrial node firing rate and cardiac pacing in vivo.
    Authors: Lai Et al.
    Am J Physiol Heart Circ Physiol 2014;307:H1327
  4. Mechanisms underlying activation of transient BK current in rabbit urethral smooth muscle cells and its modulation by IP3-generating agonists.
    Authors: Kyle Et al.
    Invest Ophthalmol Vis Sci 2013;305:C609
  5. Slo1 is the principal potassium channel of human spermatozoa.
    Authors: Mannowetz Et al.
    Elife (Cambridge) 2013;2:e01009
  6. Reduced vascular smooth muscle BK channel current underlies heart failure-induced vasoconstriction in mice.
    Authors: Wan Et al.
    Mol Pain 2013;27:1859
  7. The expression and relaxant effect of bitter taste receptors in human bronchi.
    Authors: Grassin-Delyle Et al.
    Respir Res 2013;14:134
  8. Norepinephrine causes a biphasic change in mammalian pinealocye membrane potential: role of alpha1B-adrenoreceptors, phospholipase C, and Ca2+.
    Authors: Zemkova Et al.
    Endocrinology 2011;152:3842
  9. Relaxant effect and possible mechanism of 17-nor-subincanadine E in rabbit corpora cavernosa.
    Authors: Benvindo Et al.
    Asian J Androl 2011;13:747

Have you used Iberiotoxin?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Note:

Contact Information

Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee

or select another batch: 

Feedback

Customer Information