Iberiotoxin

  ( 14 citations )    
Product Datasheet
Catalog Number:1086
Chemical Name:
Product Details
Citations (14)
Reviews
Biological Activity
Selective blocker of the big conductance Ca2+-activated K+ channel.
Technical Data
  • M.Wt:
    4230
  • Formula:
    C179H274N50O55S7
  • Sequence:
    XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ

    (Modifications: X-1 = pGlu, Disulfide bridge between 7 - 28,13 - 33,17 - 35)

  • Solubility:
    Soluble to 0.70 mg/ml in water
  • Storage:
    Desiccate at -20°C
  • CAS No:
    129203-60-7
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis. All Tocris products are intended for laboratory research use only.
Product Datasheets
COA view current batch
or select another batch:
Citations:

The citations listed below are publications that use Tocris products. Selected citations for Iberiotoxin include:

14 Citations: Showing 1 - 10
Filter your results:

  1. BK Channels Localize to the Paranodal Junction and Regulate Action Potentials in Myelinated Axons of Cerebellar Purkinje Cells.
    Authors: Hirono Et al.
    Am J Physiol Cell Physiol  2015;35:7082
  2. The role of K+ and Cl- channels in the regulation of retinal arteriolar tone and blood flow.
    Authors: Needham Et al.
    FASEB J  2014;55:2157
  3. Maternal nutrient restriction during pregnancy impairs an endothelium-derived hyperpolarizing factor-like pathway in sheep fetal coronary arteries.
    Authors: Shukla Et al.
    Am J Physiol Heart Circ Physiol  2014;307:H134
  4. BK channels regulate sinoatrial node firing rate and cardiac pacing in vivo.
    Authors: Lai Et al.
    Am J Physiol Heart Circ Physiol  2014;307:H1327
  5. Bupivacaine-induced Vasodilation Is Mediated by Decreased Calcium Sensitization in Isolated Endothelium-denuded Rat Aortas Precontracted with Phenylephrine.
    Authors: Ok Et al.
    Korean J Pain  2014;27:229
  6. Quercetin acutely relaxes airway smooth muscle and potentiates β-agonist-induced relaxation via dual phosphodiesterase inhibition of PLCβ and PDE4.
    Authors: Townsend and Emala
    Am J Physiol Lung Cell Mol Physiol  2013;305:L396
  7. Mechanisms underlying activation of transient BK current in rabbit urethral smooth muscle cells and its modulation by IP3-generating agonists.
    Authors: Kyle Et al.
    Invest Ophthalmol Vis Sci  2013;305:C609
  8. Slo1 is the principal potassium channel of human spermatozoa.
    Authors: Mannowetz Et al.
    Elife (Cambridge)  2013;2:e01009
  9. Reduced vascular smooth muscle BK channel current underlies heart failure-induced vasoconstriction in mice.
    Authors: Wan Et al.
    Mol Pain  2013;27:1859
  10. The expression and relaxant effect of bitter taste receptors in human bronchi.
    Authors: Grassin-Delyle Et al.
    Respir Res  2013;14:134
  11. Norepinephrine causes a biphasic change in mammalian pinealocye membrane potential: role of alpha1B-adrenoreceptors, phospholipase C, and Ca2+.
    Authors: Zemkova Et al.
    Endocrinology  2011;152:3842
  12. Relaxant effect and possible mechanism of 17-nor-subincanadine E in rabbit corpora cavernosa.
    Authors: Benvindo Et al.
    Asian J Androl  2011;13:747
  13. Role of perivascular adipose tissue-derived methyl palmitate in vascular tone regulation and pathogenesis of hypertension.
    Authors: Lee Et al.
    Circulation  2011;124:1160
  14. Ionic basis of ON and OFF persistent activity in layer III lateral entorhinal cortical principal neurons.
    Authors: Tahvildari Et al.
    J Neurophysiol  2008;99:2006
Expand to show all Citations

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Have you used Iberiotoxin?

Submit a review and receive a $25US/€18/£15/$25CAN amazon gift card if you include an image - $10US/€7/£6/$10CAN Amazon card for reviews without an image. Limited to verified customers in USA, Canada and Europe.

Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.

Order Details

Contact Us to Order
reload

Feedback

Customer Information
Calculators

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.
=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

R&D Systems Guarantee