IDH3B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35384

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all IDH3B Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 35-170 of human IDH3B (NP_008830.2).

Sequence:
ASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for IDH3B Antibody - BSA Free

IDH3B Antibody

Immunocytochemistry/ Immunofluorescence: IDH3B Antibody [NBP3-35384] -

Immunocytochemistry/ Immunofluorescence: IDH3B Antibody [NBP3-35384] - Immunofluorescence analysis of L929 cells using IDH3B Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
IDH3B Antibody

Western Blot: IDH3B Antibody [NBP3-35384] -

Western Blot: IDH3B Antibody [NBP3-35384] - Western blot analysis of lysates from Rat heart, using IDH3B Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
IDH3B Antibody

Western Blot: IDH3B Antibody [NBP3-35384] -

Western Blot: IDH3B Antibody [NBP3-35384] - Western blot analysis of various lysates using IDH3B Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.

Applications for IDH3B Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: IDH3B

IDH3B codes for a protein that has three isoforms, with lengths of 385, 383, and 233 amino acids, and weights of 42, 42, and 26 kDa respectively, and is a protein that is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase, which localizes to the mitochondrial matrix. Current studies are being done on several diseases and disorders related to this gene, including retinitis pigmentosa, blindness, and ataxia. IDH3B has also been shown to have interactions with MAPK6, MYC, IDH3G, PHLDA3, and IDH3A in pathways such as the TCA cycle and metabolic pathways.

Alternate Names

EC 1.1.1, EC 1.1.1.41, FLJ11043, H-IDHB, isocitrate dehydrogenase [NAD] subunit beta, mitochondrial, isocitrate dehydrogenase 3 (NAD+) beta, isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, beta subunit, Isocitric dehydrogenase subunit beta, MGC903, NAD(+)-specific ICDH subunit beta, NAD+-specific ICDH, NAD+-specific isocitrate dehydrogenase b subunit, NAD+-specific isocitrate dehydrogenase beta, RP46

Gene Symbol

IDH3B

Additional IDH3B Products

Product Documents for IDH3B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for IDH3B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IDH3B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IDH3B Antibody - BSA Free and earn rewards!

Have you used IDH3B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies