Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 46N7E3

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Description

Novus Biologicals Mouse IL-17RE Antibody (46N7E3) - Azide and BSA Free (NBP2-27368) is a monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for IL-17RE Antibody (46N7E3) - Azide and BSA Free

Western Blot: IL-17RE Antibody (46N7E3)Azide Free [NBP2-27367]

Western Blot: IL-17RE Antibody (46N7E3)Azide Free [NBP2-27367]

Western Blot: IL-17 RE Antibody (46N7E3) - Azide Free [NBP2-27367] - Analysis of IL-17RE using a partial recombinant protein (amino acids 97-199) probed with IL-17RE antibody at 5 ug/ml. Goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: IL-17RE Antibody (46N7E3) - Azide Free [NBP2-27367]

Immunohistochemistry-Paraffin: IL-17RE Antibody (46N7E3) - Azide Free [NBP2-27367]

Immunohistochemistry-Paraffin: IL-17 RE Antibody (46N7E3) - Azide Free [NBP2-27367] - Analysis of IL-17RE in formalin-fixed, paraffin-embedded human kidney tissue using IL-17RE antibody at 10 ug/ml.

Applications for IL-17RE Antibody (46N7E3) - Azide and BSA Free

Application
Recommended Usage

Immunohistochemistry-Paraffin

10ug/ml~

Western Blot

5-10ug/ml~

Formulation, Preparation, and Storage

Purification

Protein G purified

Formulation

Sterile - filtered PBS

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IL-17RE

Th17 cells are a subset of T helper cells with proinflammatory activities through the production of IL-17. IL-17RE is the receptor which recognizes the IL-17C, also known as IL-21, isoform of IL-17. IL-17C is thought to bind to IL-17RE - IL-17RA heterodimeric complexes and initiate signaling and activation cascades (1-4). IL-17RE signaling through IL17C also appears to act together with IL-22 in the induction of antibacterial peptides in colonic epithelial cells in host mucosal infection (3). IL-17RE defects lead to impaired IL-17C signaling and response to Clostridium rodentium, an analog of mucosal enteropathgenic infection of E coli in humans (1).The IL-17C isoform and the signaling pathway through IL-17RE has also been demonstrated in studies of psoriatic skin lesions (2). Undoubtedly, the different IL-17 isoforms and their particular receptors can be characterized with antibodies such as this one specific for IL-17RE to demonstrate specific and relative roles in mediating protective anti-host responses or inflammatory processes as part of the autoimmune disorders.

Long Name

Interleukin 17 Receptor E

Alternate Names

IL-17 RE, IL17RE, Il25r

Gene Symbol

IL17RE

Additional IL-17RE Products

Product Documents for IL-17RE Antibody (46N7E3) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IL-17RE Antibody (46N7E3) - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IL-17RE Antibody (46N7E3) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review IL-17RE Antibody (46N7E3) - Azide and BSA Free and earn rewards!

Have you used IL-17RE Antibody (46N7E3) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

IL-17 Family Signaling Pathways IL-17 Family Signaling Pathway Thumbnail