IL-17RE Antibody (46N7E3) - Azide and BSA Free
Novus Biologicals | Catalog # NBP2-27367
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG2b Kappa Clone # 46N7E3
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE
Clonality
Monoclonal
Host
Mouse
Isotype
IgG2b Kappa
Description
Novus Biologicals Mouse IL-17RE Antibody (46N7E3) - Azide and BSA Free (NBP2-27368) is a monoclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Scientific Data Images for IL-17RE Antibody (46N7E3) - Azide and BSA Free
Western Blot: IL-17RE Antibody (46N7E3)Azide Free [NBP2-27367]
Western Blot: IL-17 RE Antibody (46N7E3) - Azide Free [NBP2-27367] - Analysis of IL-17RE using a partial recombinant protein (amino acids 97-199) probed with IL-17RE antibody at 5 ug/ml. Goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.Immunohistochemistry-Paraffin: IL-17RE Antibody (46N7E3) - Azide Free [NBP2-27367]
Immunohistochemistry-Paraffin: IL-17 RE Antibody (46N7E3) - Azide Free [NBP2-27367] - Analysis of IL-17RE in formalin-fixed, paraffin-embedded human kidney tissue using IL-17RE antibody at 10 ug/ml.Applications for IL-17RE Antibody (46N7E3) - Azide and BSA Free
Application
Recommended Usage
Immunohistochemistry-Paraffin
10ug/ml~
Western Blot
5-10ug/ml~
Formulation, Preparation, and Storage
Purification
Protein G purified
Formulation
Sterile - filtered PBS
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: IL-17RE
Long Name
Interleukin 17 Receptor E
Alternate Names
IL-17 RE, IL17RE, Il25r
Gene Symbol
IL17RE
Additional IL-17RE Products
Product Documents for IL-17RE Antibody (46N7E3) - Azide and BSA Free
Product Specific Notices for IL-17RE Antibody (46N7E3) - Azide and BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for IL-17RE Antibody (46N7E3) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review IL-17RE Antibody (46N7E3) - Azide and BSA Free and earn rewards!
Have you used IL-17RE Antibody (46N7E3) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...