Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Alexa Fluor Plus 488 (Excitation = 493 nm, Emission = 518 nm)

Antibody Source

Monoclonal Mouse IgG2b Kappa Clone # 46N7E3
Loading...

Product Specifications

Immunogen

amino acids (97-199) MVHLLVQkSkkSSTFkFYRRHkMPAPAQRkLLPRRHLSEkSHHISIPSPDISHkGLRSkR~TQPSDPETWESLPRLDSQRHGGPEFSFDLLPEARAIRVTISSGPE

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2b Kappa

Applications for IL-17RE Antibody (46N7E3) [Alexa Fluor™ Plus 488]

Application
Recommended Usage

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Formulation, Preparation, and Storage

Purification

Protein G purified

Formulation

50mM Sodium Borate

Preservative

0.05% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: IL-17RE

Interleukin-17 Receptor E (IL-17RE) is a transmembrane protein that is expressed on mucosal epithelial cells, keratinocytes, Th17 cells, and gamma delta T cells. It associates with IL-17RA to form a heterodimeric receptor for IL-17C. Binding of IL-17C to this receptor complex promotes mucosal immunity by stimulating the production of anti-bacterial peptides and pro-inflammatory cytokines and chemokines. Additionally, IL-17C signaling regulates Th17 cell-dependent immune responses and has been suggested to contribute to psoriatic skin thickening, the progression of arthritis, and the pathogenesis of autoimmune diseases.

Long Name

Interleukin 17 Receptor E

Alternate Names

IL-17 RE, IL17RE, Il25r

Gene Symbol

IL17RE

Additional IL-17RE Products

Product Documents for IL-17RE Antibody (46N7E3) [Alexa Fluor™ Plus 488]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IL-17RE Antibody (46N7E3) [Alexa Fluor™ Plus 488]



This product is provided under an intellectual property license from Life Technologies Corporation. The transfer of this product is conditioned on the buyer using the purchased product solely in research conducted by the buyer, excluding contract research or any fee for service research, and the buyer must not (1) use this product or its components for (a) diagnostic, therapeutic or prophylactic purposes; (b) testing, analysis or screening services, or information in return for compensation on a per-test basis; or (c) manufacturing or quality assurance or quality control, and/or (2) sell or transfer this product or its components for resale, whether or not resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5781 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@thermofisher.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for IL-17RE Antibody (46N7E3) [Alexa Fluor™ Plus 488]

There are currently no reviews for this product. Be the first to review IL-17RE Antibody (46N7E3) [Alexa Fluor™ Plus 488] and earn rewards!

Have you used IL-17RE Antibody (46N7E3) [Alexa Fluor™ Plus 488]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

IL-17 Family Signaling Pathways
IL-17 Family Signaling Pathway Thumbnail