ILF3 Antibody (0S2N7)

Novus Biologicals | Catalog # NBP3-16664

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0S2N7 expressed in HEK293
View all ILF3 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ILF3 (Q12906). MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ILF3 Antibody (0S2N7)

Western Blot: ILF3 Antibody (0S2N7) [NBP3-16664]

Western Blot: ILF3 Antibody (0S2N7) [NBP3-16664]

Western Blot: ILF3 Antibody (0S2N7) [NBP3-16664] - Western blot analysis of extracts of various cell lines, using ILF3 Rabbit mAb (NBP3-16664) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
ILF3 Antibody (0S2N7)

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] -

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded human cervix cancer tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ILF3 Antibody (0S2N7)

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] -

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded human colon carcinoma tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ILF3 Antibody (0S2N7)

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] -

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded mouse colon tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ILF3 Antibody (0S2N7)

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] -

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded human colon tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ILF3 Antibody (0S2N7)

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] -

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded mouse brain tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ILF3 Antibody (0S2N7)

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] -

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded human liver tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ILF3 Antibody (0S2N7)

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] -

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded rat liver tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ILF3 Antibody (0S2N7)

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] -

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded human thyroid cancer tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ILF3 Antibody (0S2N7)

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] -

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded rat colon tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ILF3 Antibody (0S2N7)

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] -

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded mouse lung tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ILF3 Antibody (0S2N7)

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] -

Immunohistochemistry: ILF3 Antibody (0S2N7) [NBP3-16664] - Immunohistochemistry analysis of ILF3 in paraffin-embedded mouse testis tissue using ILF3 Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for ILF3 Antibody (0S2N7)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ILF3

ILF3 encodes a double-stranded RNA (dsRNA) binding protein that complexes with other proteins, dsRNAs, small noncoding RNAs, and mRNAs to regulate gene expression and stabilize mRNAs. This protein was first discovered to be a subunit of the nuclear factor of activated T-cells (NFAT); a transcription factor required for T-cell expression of interleukin 2. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. These proteins have been shown to affect the redistribution of nuclear mRNA to the cytoplasm. Knockdown of NF45 or NF90 protein retards cell growth; possibly by inhibition of mRNA stabilization. In contrast, an isoform (NF110) of this gene that is predominantly restricted to the nucleus has only minor effects on cell growth when its levels are reduced. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Alternate Names

Double-stranded RNA-binding protein 76, double-stranded RNA-binding protein, 76 kD, DRBF, DRBP76M-phase phosphoprotein 4, dsRNA binding protein NFAR-2/MPP4, interleukin enhancer binding factor 3, 90kDa, interleukin enhancer-binding factor 3, MPHOSPH4interleukin enhancer binding factor 3, 90kD, MPP4MMP4, NF90CBTF, NFAR-1, NFAR2, NFARNF110, NF-AT-90, Nuclear factor associated with dsRNA, Nuclear factor of activated T-cells 90 kDa, nuclear factor of activated T-cells, 90 kD, TCP110, TCP80, Translational control protein 80

Gene Symbol

ILF3

Additional ILF3 Products

Product Documents for ILF3 Antibody (0S2N7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ILF3 Antibody (0S2N7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ILF3 Antibody (0S2N7)

There are currently no reviews for this product. Be the first to review ILF3 Antibody (0S2N7) and earn rewards!

Have you used ILF3 Antibody (0S2N7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies