Indoleamine 2,3-dioxygenase/IDO Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-87702
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western
Cited:
Immunohistochemistry-Paraffin, Western Blot, IF/IHC
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLK
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Indoleamine 2,3-dioxygenase/IDO Antibody - BSA Free
Western Blot: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702]
Western Blot: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Analysis in human cell line EFO-21.Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702]
Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Staining of human lymph node shows strong cytoplasmic and nuclear positivity in non-germinal center cells.Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702]
Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Immunohistochemical staining of human placenta shows strong cytoplasmic and nuclear positivity in endothelial cells.Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702]
Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Immunohistochemical staining of human cerebral cortex shows no positivity as expected.Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702]
Immunohistochemistry-Paraffin: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Immunohistochemical staining of human small intestine shows strong cytoplasmic and nuclear positivity in a subset of leukocytes.Simple Western: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702]
Simple Western: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Simple Western lane view shows a specific band for IDO1 in 0.2 mg/ml of OVCAR-3 (left), h. Tonsil, raji, daudi lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.Simple Western: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702]
Simple Western: Indoleamine 2,3-dioxygenase/IDO Antibody [NBP1-87702] - Electropherogram image(s) of corresponding Simple Western lane view. Indoleamine 2,3-dioxygenase/IDO antibody was used at 1:20 dilution on OVCAR-3, h. Tonsil, Raji, and Daudi lysate(s).Applications for Indoleamine 2,3-dioxygenase/IDO Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Simple Western
1:20
Western Blot
0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in OVCAR-3, h. Tonsil, raji, daudi, separated by Size, antibody dilution of 1:20, apparent MW was 69 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in OVCAR-3, h. Tonsil, raji, daudi, separated by Size, antibody dilution of 1:20, apparent MW was 69 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Indoleamine 2,3-dioxygenase/IDO
Alternate Names
3dioxygenase, IDO, IDO1, INDO, Indoleamine 2
Entrez Gene IDs
3620 (Human)
Gene Symbol
IDO1
UniProt
Additional Indoleamine 2,3-dioxygenase/IDO Products
Product Documents for Indoleamine 2,3-dioxygenase/IDO Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Indoleamine 2,3-dioxygenase/IDO Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for Indoleamine 2,3-dioxygenase/IDO Antibody - BSA Free
Customer Reviews for Indoleamine 2,3-dioxygenase/IDO Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Indoleamine 2,3-dioxygenase/IDO Antibody - BSA Free and earn rewards!
Have you used Indoleamine 2,3-dioxygenase/IDO Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...