Inhibin alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87563

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLAT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Inhibin alpha Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Inhibin alpha Antibody [NBP1-87563]

Immunocytochemistry/ Immunofluorescence: Inhibin alpha Antibody [NBP1-87563]

Immunocytochemistry/Immunofluorescence: Inhibin alpha Antibody [NBP1-87563] - Staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563]

Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563]

Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563] - Staining in human testis and endometrium tissues using anti-INHA antibody. Corresponding INHA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563]

Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563]

Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563]

Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563]

Immunohistochemistry-Paraffin: Inhibin alpha Antibody [NBP1-87563] - Staining of human testis shows high expression.

Applications for Inhibin alpha Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Inhibin A

INHA(A-inhibin subunit precursor, inhibin alpha subunit ),also called inhibin(alpha),which is located on chromosome 2q33-q36. Inhibin is a gonadal protein that preferentially suppresses the secretion of pituitary follicle-stimulating hormone (FSH). Inhibin comprises of two subunits,Inhibin A and B. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumor suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa cell tumors and can therefore be used as a marker for primary as well as recurrent disease. In addition to their role in endocrine feedback in the reproductive sytem, inhibins subserve local regulatory roles in numerous extragonadal tissues, including brain, adrenal,bone marrow, placenta, and most notably anterior pituitary. Inhibin alpha subunit gene expression is down regulated in human prostate cancer, suggesting a tumor suppressive role.

Alternate Names

INHA, Inhibin A

Gene Symbol

INHA

Additional Inhibin A Products

Product Documents for Inhibin alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Inhibin alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Inhibin alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Inhibin alpha Antibody - BSA Free and earn rewards!

Have you used Inhibin alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...