INO80C Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-14123
![Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123]](https://resources.rndsystems.com/images/products/INO80C-Antibody-Immunohistochemistry-Paraffin-NBP2-14123-img0006.jpg "Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123]")
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: GYGASKKKKASASSFAQGISMEAMSENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRT
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (87%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for INO80C Antibody - BSA Free
![Immunocytochemistry/ Immunofluorescence: INO80C Antibody [NBP2-14123]](https://resources.rndsystems.com/images/products/INO80C-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14123-img0005.jpg "Immunocytochemistry/ Immunofluorescence: INO80C Antibody [NBP2-14123]")
Immunocytochemistry/ Immunofluorescence: INO80C Antibody [NBP2-14123]
Immunocytochemistry/Immunofluorescence: INO80C Antibody [NBP2-14123] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.![Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123]](https://resources.rndsystems.com/images/products/INO80C-Antibody-Immunohistochemistry-Paraffin-NBP2-14123-img0009.jpg "Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123]")
Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123]
Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123] - Staining of human kidney shows weak to moderate positivity in cells in tubules.![Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123]](https://resources.rndsystems.com/images/products/INO80C-Antibody-Immunohistochemistry-Paraffin-NBP2-14123-img0007.jpg "Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123]")
Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123]
Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123] - Staining of human testis shows weak nuclear positivity in cells in seminiferous ducts.![Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123]](https://resources.rndsystems.com/images/products/INO80C-Antibody-Immunohistochemistry-Paraffin-NBP2-14123-img0008.jpg "Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123]")
Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123]
Immunohistochemistry-Paraffin: INO80C Antibody [NBP2-14123] - Staining of human skeletal muscle shows very weak positivity in myocytes.![INO80C Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: INO80C Antibody - BSA Free [NBP2-14123]](https://resources.rndsystems.com/images/products/nbp2-14123_rabbit-polyclonal-ino80c-antibody-25620259121981.jpg "Chromatin Immunoprecipitation-exo-Seq: INO80C Antibody - BSA Free [NBP2-14123]")
Chromatin Immunoprecipitation-exo-Seq: INO80C Antibody - BSA Free [NBP2-14123]
ChIP-Exo-Seq composite graph for Anti-INO80C (NBP2-14123) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.Applications for INO80C Antibody - BSA Free
Application
Recommended Usage
Chromatin Immunoprecipitation-exo-Seq
1-10ug per reaction
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200-1:500
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: INO80C
Alternate Names
C18orf37, chromosome 18 open reading frame 37, FLJ38183, hIes6, IES6, IES6 homolog, INO80 complex subunit C
Gene Symbol
INO80C
Additional INO80C Products
Product Documents for INO80C Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for INO80C Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for INO80C Antibody - BSA Free
There are currently no reviews for this product. Be the first to review INO80C Antibody - BSA Free and earn rewards!
Have you used INO80C Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...