Integrin alpha 5/CD49e Antibody (8F2O6)

Name: Integrin alpha 5/CD49e Antibody (8F2O6)
Brand: Novus Biologicals
SKU: NBP3-15645
Price: 429 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-15645

Submit a review

Product Documents

Recombinant Monoclonal Antibody

100% Guarantee

Product Specifications
Scientific Data
Applications
Flow Cytometry
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Flow Cytometry, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8F2O6 expressed in HEK293

View all Integrin alpha 5/CD49e Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5/CD49e (P08648). HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Integrin alpha 5/CD49e Antibody (8F2O6)

Western Blot: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645]

Western Blot: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645] - Analysis of extracts of various cell lines, using Integrin alpha 5/CD49e (ITGA5/CD49e) antibody (NBP3-15645) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645]

Western Blot: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645] - Analysis of extracts of A-549 cells, using Integrin alpha 5/CD49e (ITGA5/CD49e) antibody (NBP3-15645) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Western Blot: Integrin alpha 5/CD49e Antibody (8F2O6) [NBP3-15645]

Flow Cytometry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] -

Flow Cytometry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Flow cytometry:1X10^6 Daudi cells (negative control,left) and K-562 cells were intracellularly-stained with Integrin alpha 5/CD49e Rabbit mAb or Rabbit IgG isotype control,followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained cells were used as blank control.

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] -

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] -

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] -

Immunocytochemistry/ Immunofluorescence: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Confocal imaging of paraffin-embedded Human placenta using Integrin alpha 5/CD49e Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] -

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] -

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] -

Immunocytochemistry/ Immunofluorescence: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Confocal imaging of paraffin-embedded Rat large intestine using Integrin alpha 5/CD49e Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] -

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Flow Cytometry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] -

Flow Cytometry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Flow cytometry:1X10^6 Daudi cells (negative control,left) and U-87MG cells were intracellularly-stained with Integrin alpha 5/CD49e Rabbit mAb or Rabbit IgG isotype control,followed by Alexa Fluor 647 conjugated goat anti-rabbit pAb(1:600 dilution) staining. Non-fluorescently stained cells were used as blank control.

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] -

Immunohistochemistry: Integrin alpha 5/CD49e Antibody (8F2O6) [Integrin alpha 5/CD49e] - Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using Integrin alpha 5/CD49e Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

View 10 more images

Applications for Integrin alpha 5/CD49e Antibody (8F2O6)

Application

Recommended Usage

Flow Cytometry

1:50 - 1:200

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Flow Cytometry Panel Builder

Bio-Techne Knows Flow Cytometry

Save time and reduce costly mistakes by quickly finding compatible reagents using the Panel Builder Tool.

Advanced Features

Spectra Viewer - Custom analysis of spectra from multiple fluorochromes
Spillover Popups - Visualize the spectra of individual fluorochromes
Antigen Density Selector - Match fluorochrome brightness with antigen density

Build Your Panel Now

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Integrin alpha 5/CD49e

CD49e is a type I integral membrane glycoprotein, known as alpha5 integrin, VLA-5 alpha chain. It forms noncovalent heterodimer with integrin beta1 (CD29). CD49e contains two disulfide-linked subunits of 135 kDa and 24 kDa, and is mainly expressed on thymocytes, activated lymphocytes, endothelial cells, osteoblasts, melanoma, and some myeloid leukemia cells. CD49e/CD29 complex binds to fibronection and neural adhesion molecule L1. It mediates monocytes migration, involves in the regulation of cells survival and apoptosis, and co-stimulates T cell activation.

Alternate Names

CD49e, ITGA5, VLA-5 alpha

Gene Symbol

ITGA5

Additional Integrin alpha 5/CD49e Products

Product Documents for Integrin alpha 5/CD49e Antibody (8F2O6)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Integrin alpha 5/CD49e Antibody (8F2O6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.