INTS6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85302

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all INTS6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQ

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for INTS6 Antibody - BSA Free

Western Blot: INTS6 Antibody [NBP1-85302]

Western Blot: INTS6 Antibody [NBP1-85302]

Western Blot: INTS6 Antibody [NBP1-85302] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431
Immunocytochemistry/ Immunofluorescence: INTS6 Antibody [NBP1-85302]

Immunocytochemistry/ Immunofluorescence: INTS6 Antibody [NBP1-85302]

Immunocytochemistry/Immunofluorescence: INTS6 Antibody [NBP1-85302] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302]

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302]

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302]

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302]

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302] - Analysis in human testis and skeletal muscle tissues. Corresponding INTS6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302]

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302]

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302]

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302]

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302] - Staining of human prostate shows weak nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302]

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302]

Immunohistochemistry-Paraffin: INTS6 Antibody [NBP1-85302] - Staining of human skeletal muscle shows low positivity in myocytes as expected.
INTS6 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: INTS6 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: INTS6 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-INTS6 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for INTS6 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: INTS6

The tumor suppressor gene DICE1 is located within a previously reported critical region of loss of heterozygosity on chromosome 13q14.3. Expression of the remaining DICE1 allele is down-regulated in non-small cell lung carcinomas. In IGF-IR transformed Balb/c 3T3, DICE1 substantially suppressed growth in soft agar. These results demonstrate that DICE1 has a growth-suppressing activity and interferes with anchorage-independent growth of IGF-IR transformed tumor cells dependent upon IGF-I signaling.

Alternate Names

DBI1, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26, DICE1DBI-1DDX26ADDX26DEAD box protein, DKFZp434B105, HDB, Int6, integrator complex subunit 6, Notchl2, Protein DDX26, Protein deleted in cancer 1, RNA helicase HDB

Gene Symbol

INTS6

Additional INTS6 Products

Product Documents for INTS6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for INTS6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for INTS6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review INTS6 Antibody - BSA Free and earn rewards!

Have you used INTS6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies