IQGAP1 Antibody (2C5) - Azide and BSA Free
Novus Biologicals | Catalog # H00008826-M01
Loading...
Key Product Details
Validated by
Knockout/Knockdown
Species Reactivity
Validated:
Human
Cited:
Human
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated
Cited:
Western Blot, IF/IHC
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 2C5
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
IQGAP1 (NP_003861, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEP
Specificity
IQGAP1 - IQ motif containing GTPase activating protein 1
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for IQGAP1 Antibody (2C5) - Azide and BSA Free
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01]
IQGAP1-Antibody-2C5-Western-Blot-H00008826-M01-img0012.jpgImmunocytochemistry/ Immunofluorescence: IQGAP1 Antibody (2C5) [H00008826-M01]
Immunocytochemistry/Immunofluorescence: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on HeLa cell. Antibody concentration 10 ug/ml.Immunohistochemistry-Paraffin: IQGAP1 Antibody (2C5) [H00008826-M01]
Immunohistochemistry-Paraffin: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 1 ug/ml.Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01]
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 monoclonal antibody (M01), clone 2C5 Analysis of IQGAP1 expression in C32.
Sandwich ELISA: IQGAP1 Antibody (2C5) [H00008826-M01] - Detection limit for recombinant GST tagged IQGAP1 is approximately 3ng/ml as a capture antibody.
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] -
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - indicates that IQGAP1 mRNA & protein levels in HO-8910PM-shIQGAP1, HO-8910PM-shRNA negative & un-transfected HO-8910PM cells were determined by RT-PCR & Western blot analysis, respectively. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/19036171), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] -
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - shows that IQGAP1 expression & cell invasive phenotype in ovarian cancer cell lines. (a) RT-PCR analysis for IQGAP1 using total RNA form HO-8910, SK-OV-3 & HO-8910PM cells. (b) Western blot analysis for IQGAP1 in whole-cell lysates from the indicated cell lines. (c) High IQGAP1 expression associated with enhanced invasive potential of ovarian cancer cells. HO-8910, SK-OV-3 & HO-8910PM cells were seeded onto a Matrigel-coated invasion chamber & the number of invading cells was determined as described before. *, P < 0.05 versus SK-OV-3 or HO-8910 cells. (d) High IQGAP1 expression correlated with enhanced migratory potential of ovarian cancer cells. HO-8910, SK-OV-3 & HO-8910PM cells were seeded onto a Boyden chamber & the number of migrating cells was determined as described before. *, P < 0.05 versus SK-OV-3 or HO-8910 cells. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/19036171), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] -
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 induces the epithelial-to-mesenchymal transition, invasiveness, & proliferation of endometrial cancer (EC) cellsA. Reverse transcription quantitative PCR (qPCR) analysis of IQGAP1 mRNA in the immortalized human endometrial cell line EM & the EC cells HEC-1, HEC-50, & HEC-50-HI (HI). The results are presented as the fold-change in expression compared to the EM cells. B. Western blot analysis of the IQGAP1 protein in EC cells. C, E. The expression of IQGAP1, E-cadherin, & N-cadherin proteins in HI cells transfected with control (Ctr) or IQGAP1 siRNA (C) & in HEC-1 cells expressing either the control or IQGAP1 vector (E). D, F. Phase-contrast microscopy shows the morphology of HI cells transfected with control or IQGAP1 siRNA (D) & HEC-1 cells transfected with the control or IQGAP1 vector (F). G-I. Detection of migration (G), invasion (H), & proliferation (I) in HI & HEC-1 cells after the indicated transfection. J, K. qPCR analysis of ZO-1, CK-18, & Vimentin expression in HI (J) & HEC-1 (K) cells, transfected as indicated. L. Representative images from the invasion assays. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.7754), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] -
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 induces the epithelial-to-mesenchymal transition, invasiveness, & proliferation of endometrial cancer (EC) cellsA. Reverse transcription quantitative PCR (qPCR) analysis of IQGAP1 mRNA in the immortalized human endometrial cell line EM & the EC cells HEC-1, HEC-50, & HEC-50-HI (HI). The results are presented as the fold-change in expression compared to the EM cells. B. Western blot analysis of the IQGAP1 protein in EC cells. C, E. The expression of IQGAP1, E-cadherin, & N-cadherin proteins in HI cells transfected with control (Ctr) or IQGAP1 siRNA (C) & in HEC-1 cells expressing either the control or IQGAP1 vector (E). D, F. Phase-contrast microscopy shows the morphology of HI cells transfected with control or IQGAP1 siRNA (D) & HEC-1 cells transfected with the control or IQGAP1 vector (F). G-I. Detection of migration (G), invasion (H), & proliferation (I) in HI & HEC-1 cells after the indicated transfection. J, K. qPCR analysis of ZO-1, CK-18, & Vimentin expression in HI (J) & HEC-1 (K) cells, transfected as indicated. L. Representative images from the invasion assays. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.7754), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for IQGAP1 Antibody (2C5) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Immunocytochemistry/ Immunofluorescence
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry-Paraffin
Optimal dilutions of this antibody should be experimentally determined.
Knockdown Validated
Optimal dilutions of this antibody should be experimentally determined.
Sandwich ELISA
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 19706805).
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: IQGAP1
Long Name
IQ Motif Containing GTPase Activating Protein 1
Alternate Names
p195, SAR1
Entrez Gene IDs
8826 (Human)
Gene Symbol
IQGAP1
OMIM
603379 (Human)
UniProt
Additional IQGAP1 Products
Product Documents for IQGAP1 Antibody (2C5) - Azide and BSA Free
Product Specific Notices for IQGAP1 Antibody (2C5) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for IQGAP1 Antibody (2C5) - Azide and BSA Free
Customer Reviews for IQGAP1 Antibody (2C5) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review IQGAP1 Antibody (2C5) - Azide and BSA Free and earn rewards!
Have you used IQGAP1 Antibody (2C5) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...