IQGAP1 Antibody (2C5) - Azide and BSA Free

Novus Biologicals | Catalog # H00008826-M01

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot, IF/IHC

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG1 kappa Clone # 2C5

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

IQGAP1 (NP_003861, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEP

Specificity

IQGAP1 - IQ motif containing GTPase activating protein 1

Clonality

Monoclonal

Host

Mouse

Isotype

IgG1 kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for IQGAP1 Antibody (2C5) - Azide and BSA Free

Knockdown Validated: IQGAP1 Antibody (2C5) [H00008826-M01]

Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01]

IQGAP1-Antibody-2C5-Knockdown-Validated-H00008826-M01-img0011.jpg
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01]

Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01]

IQGAP1-Antibody-2C5-Western-Blot-H00008826-M01-img0012.jpg
Immunocytochemistry/ Immunofluorescence: IQGAP1 Antibody (2C5) [H00008826-M01]

Immunocytochemistry/ Immunofluorescence: IQGAP1 Antibody (2C5) [H00008826-M01]

Immunocytochemistry/Immunofluorescence: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: IQGAP1 Antibody (2C5) [H00008826-M01]

Immunohistochemistry-Paraffin: IQGAP1 Antibody (2C5) [H00008826-M01]

Immunohistochemistry-Paraffin: IQGAP1 Antibody (2C5) [H00008826-M01] - Analysis of monoclonal antibody to IQGAP1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 1 ug/ml.
Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01]

Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01]

Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 monoclonal antibody (M01), clone 2C5 Analysis of IQGAP1 expression in C32.
Sandwich ELISA: IQGAP1 Antibody (2C5) [H00008826-M01] - Detection limit for recombinant GST tagged IQGAP1 is approximately 3ng/ml as a capture antibody.
IQGAP1 Antibody (2C5)

Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] -

Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - indicates that IQGAP1 mRNA & protein levels in HO-8910PM-shIQGAP1, HO-8910PM-shRNA negative & un-transfected HO-8910PM cells were determined by RT-PCR & Western blot analysis, respectively. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/19036171), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
IQGAP1 Antibody (2C5)

Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] -

Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - shows that IQGAP1 expression & cell invasive phenotype in ovarian cancer cell lines. (a) RT-PCR analysis for IQGAP1 using total RNA form HO-8910, SK-OV-3 & HO-8910PM cells. (b) Western blot analysis for IQGAP1 in whole-cell lysates from the indicated cell lines. (c) High IQGAP1 expression associated with enhanced invasive potential of ovarian cancer cells. HO-8910, SK-OV-3 & HO-8910PM cells were seeded onto a Matrigel-coated invasion chamber & the number of invading cells was determined as described before. *, P < 0.05 versus SK-OV-3 or HO-8910 cells. (d) High IQGAP1 expression correlated with enhanced migratory potential of ovarian cancer cells. HO-8910, SK-OV-3 & HO-8910PM cells were seeded onto a Boyden chamber & the number of migrating cells was determined as described before. *, P < 0.05 versus SK-OV-3 or HO-8910 cells. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/19036171), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
IQGAP1 Antibody (2C5)

Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] -

Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 induces the epithelial-to-mesenchymal transition, invasiveness, & proliferation of endometrial cancer (EC) cellsA. Reverse transcription quantitative PCR (qPCR) analysis of IQGAP1 mRNA in the immortalized human endometrial cell line EM & the EC cells HEC-1, HEC-50, & HEC-50-HI (HI). The results are presented as the fold-change in expression compared to the EM cells. B. Western blot analysis of the IQGAP1 protein in EC cells. C, E. The expression of IQGAP1, E-cadherin, & N-cadherin proteins in HI cells transfected with control (Ctr) or IQGAP1 siRNA (C) & in HEC-1 cells expressing either the control or IQGAP1 vector (E). D, F. Phase-contrast microscopy shows the morphology of HI cells transfected with control or IQGAP1 siRNA (D) & HEC-1 cells transfected with the control or IQGAP1 vector (F). G-I. Detection of migration (G), invasion (H), & proliferation (I) in HI & HEC-1 cells after the indicated transfection. J, K. qPCR analysis of ZO-1, CK-18, & Vimentin expression in HI (J) & HEC-1 (K) cells, transfected as indicated. L. Representative images from the invasion assays. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.7754), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
IQGAP1 Antibody (2C5)

Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] -

Western Blot: IQGAP1 Antibody (2C5) [H00008826-M01] - IQGAP1 induces the epithelial-to-mesenchymal transition, invasiveness, & proliferation of endometrial cancer (EC) cellsA. Reverse transcription quantitative PCR (qPCR) analysis of IQGAP1 mRNA in the immortalized human endometrial cell line EM & the EC cells HEC-1, HEC-50, & HEC-50-HI (HI). The results are presented as the fold-change in expression compared to the EM cells. B. Western blot analysis of the IQGAP1 protein in EC cells. C, E. The expression of IQGAP1, E-cadherin, & N-cadherin proteins in HI cells transfected with control (Ctr) or IQGAP1 siRNA (C) & in HEC-1 cells expressing either the control or IQGAP1 vector (E). D, F. Phase-contrast microscopy shows the morphology of HI cells transfected with control or IQGAP1 siRNA (D) & HEC-1 cells transfected with the control or IQGAP1 vector (F). G-I. Detection of migration (G), invasion (H), & proliferation (I) in HI & HEC-1 cells after the indicated transfection. J, K. qPCR analysis of ZO-1, CK-18, & Vimentin expression in HI (J) & HEC-1 (K) cells, transfected as indicated. L. Representative images from the invasion assays. Image collected & cropped by CiteAb from the following publication (https://www.oncotarget.com/lookup/doi/10.18632/oncotarget.7754), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for IQGAP1 Antibody (2C5) - Azide and BSA Free

Application
Recommended Usage

ELISA

Optimal dilutions of this antibody should be experimentally determined.

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Knockdown Validated

Optimal dilutions of this antibody should be experimentally determined.

Sandwich ELISA

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 19706805).

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: IQGAP1

This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines.

Long Name

IQ Motif Containing GTPase Activating Protein 1

Alternate Names

p195, SAR1

Entrez Gene IDs

8826 (Human)

Gene Symbol

IQGAP1

OMIM

603379 (Human)

Additional IQGAP1 Products

Product Documents for IQGAP1 Antibody (2C5) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IQGAP1 Antibody (2C5) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Citations for IQGAP1 Antibody (2C5) - Azide and BSA Free

Customer Reviews for IQGAP1 Antibody (2C5) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review IQGAP1 Antibody (2C5) - Azide and BSA Free and earn rewards!

Have you used IQGAP1 Antibody (2C5) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

VEGF - VEGF R2 Signaling Pathways VEGF - VEGF R2 Signaling Pathway Thumbnail