IRF6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49383

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (95%), Rat (96%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KSREFNLMYDGTKEVPMNPVKIYQVCDIPQPQGSIINPGSTGSAPWDEKDNDVDEE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for IRF6 Antibody - BSA Free

Immunohistochemistry-Paraffin: IRF6 Antibody [NBP2-49383]

Immunohistochemistry-Paraffin: IRF6 Antibody [NBP2-49383]

Immunohistochemistry-Paraffin: IRF6 Antibody [NBP2-49383] - Staining in human breast and pancreas tissues using anti-IRF6 antibody. Corresponding IRF6 RNA-seq data are presented for the same tissues.
Western Blot: IRF6 Antibody [NBP2-49383]

Western Blot: IRF6 Antibody [NBP2-49383]

Western Blot: IRF6 Antibody [NBP2-49383] - Analysis using Anti-IRF6 antibody NBP2-49383 (A) shows similar pattern to independent antibody NBP2-55961 (B).
Immunocytochemistry/ Immunofluorescence: IRF6 Antibody [NBP2-49383]

Immunocytochemistry/ Immunofluorescence: IRF6 Antibody [NBP2-49383]

Immunocytochemistry/Immunofluorescence: IRF6 Antibody [NBP2-49383] - Staining of human cell line HaCaT shows localization to nucleus, cytosol & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: IRF6 Antibody [NBP2-49383]

Immunohistochemistry-Paraffin: IRF6 Antibody [NBP2-49383]

Immunohistochemistry-Paraffin: IRF6 Antibody [NBP2-49383] - Staining of human breast shows high expression.
Immunohistochemistry-Paraffin: IRF6 Antibody [NBP2-49383]

Immunohistochemistry-Paraffin: IRF6 Antibody [NBP2-49383]

Immunohistochemistry-Paraffin: IRF6 Antibody [NBP2-49383] - Staining of human pancreas shows low expression as expected.
IRF6 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: IRF6 Antibody - BSA Free [NBP2-49383] -

Overexpression of IRF6 and GRHL3 induces differentiation. (A) The differentiation status of three normal cell strains compared to three SCC lines was assessed by qPCR for a panel of differentiation markers (IRF6, GRHL3, IVL, FLG, K10, LOR, and TGM1). The data are shown as a heatmap. Scale: light green – low gene expression; red – high gene expression. (B) IF staining for TGM1, IVL, LOR, and FLG in PA-Ep (non-cancerous) vs. SCC-68 indicates less differentiated cells in the SCC-68 cultures. Scale bar: 50 um. Note that staining for LOR and TGM1 resulted in a nuclear background staining (Supplementary Figure 5). (C) The same healthy cell strains and SCC cell lines were analyzed in low density (LD) and their corresponding high density (HD) cultures, and the same set of differentiation genes was analyzed by qPCR. The results are shown as heatmap of the fold inductions (HD vs. LD). Scale: light green – low gene induction; red – high gene induction. (D) The effect of forced expression of IRF6 (black) and GRHL3 (gray) compared to control SCC-68 (white) on differentiation markers (K10, FLG, and LOR) was determined by qPCR. * p < 0.05 control vs. IRF6 and GRHL3. (E) Brightfield pictures and corresponding pictures with actin staining indicate the presence of differentiating cell groups (dashed yellow line in the brightfield images and asterisks in the actin staining) in SCC68 cells transduced with IRF6 or GRHL3. Scale bar: 50 um. (F) K10 staining in dense cultures of transduced SCC-68 cells (left) and its quantification (right). Note the presence of significantly more K10-positive cells in SCC-68/IRF6 and SCC-68/GRHL3 compared to SCC-68 control. Scale bar: 50 um. * p < 0.05 control vs. IRF6 and GRHL3. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/36457487), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for IRF6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: IRF6

IRF6 encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. This protein is involved in palate formation. [provided by RefSeq]

Long Name

Interferon Regulatory Factor 8

Alternate Names

LPS, OFC6, PIT, PPS, VWS

Gene Symbol

IRF6

Additional IRF6 Products

Product Documents for IRF6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for IRF6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for IRF6 Antibody - BSA Free

Customer Reviews for IRF6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review IRF6 Antibody - BSA Free and earn rewards!

Have you used IRF6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies