Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34091

Novus Biologicals
100% Guarantee

Key Product Details

Validated by

Knockout/Knockdown

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (95%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Isocitrate Dehydrogenase 1/IDH1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091]

Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091]

Western Blot: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-IDH1 antibody. Remaining relative intensity is presented. Loading control: anti-PPIB.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091] - Staining of human pancreas shows very weak cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091] - Staining of human prostate shows high expression.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091]

Immunohistochemistry-Paraffin: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Simple Western: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091]

Simple Western: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091]

Simple Western: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091] - Simple Western lane view shows a specific band for Isocitrate Dehydrogenase 1/IDH1 in 0.2 mg/ml of HepG2 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091]

Simple Western: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091]

Simple Western: Isocitrate Dehydrogenase 1/IDH1 Antibody [NBP2-34091] - Electropherogram image of the corresponding Simple Western lane view. Isocitrate Dehydrogenase 1/IDH1 antibody was used at 1:25 dilution on HepG2 lysate(s) respectively.

Applications for Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Simple Western

1:25

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in HepG2 lysate, separated by Size, antibody dilution of 1:25, apparent MW was 51 kDa.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Isocitrate Dehydrogenase 1/IDH1

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. [provided by RefSeq]

Alternate Names

IDCD, IDH1, IDP, IDPC, PICD

Gene Symbol

IDH1

UniProt

O75874

Additional Isocitrate Dehydrogenase 1/IDH1 Products

Product Documents for Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free and earn rewards!

Have you used Isocitrate Dehydrogenase 1/IDH1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies