JTB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81746

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: EEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for JTB Antibody - BSA Free

Western Blot: JTB Antibody [NBP1-81746]

Western Blot: JTB Antibody [NBP1-81746]

Western Blot: JTB Antibody [NBP1-81746] - Analysis in control (vector only transfected HEK293T lysate) and JTB over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: JTB Antibody [NBP1-81746]

Immunocytochemistry/ Immunofluorescence: JTB Antibody [NBP1-81746]

Immunocytochemistry/Immunofluorescence: JTB Antibody [NBP1-81746] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: JTB Antibody [NBP1-81746]

Immunohistochemistry-Paraffin: JTB Antibody [NBP1-81746]

Immunohistochemistry-Paraffin: JTB Antibody [NBP1-81746] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Applications for JTB Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: JTB

JTB, also known as Protein JTB, has a 146 amino acid long isoform that is 16 kDa and a short 117 amino acid that is 13 kDa; needed for normal cytokinesis during mitosis, participates in the regulation of cell proliferation, may be a component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly, fosters AURKB activity, its overexpression induces swelling of mitochondria and reduces mitochondrial membrane potential. Disease research is currently being studied with relation to JTB and lymph node tuberculosis, tuberculous meningitis, abdominal tuberculosis, prostatitis, hepatocellular carcinoma, carcinoma, and adenoid cystic carcinoma. The protein has been shown to interact with AURKA, AURKB, BIRC5, INCENP, and LIG3 proteins in apoptotic process, regulation of cell proliferation, cell cycle cytokinesis, mitosis, and cell cycle pathways.

Long Name

Jumping Translocation Breakpoint

Alternate Names

Gm622, HSPC222, PAR Protein

Gene Symbol

JTB

Additional JTB Products

Product Documents for JTB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for JTB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for JTB Antibody - BSA Free

Customer Reviews for JTB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review JTB Antibody - BSA Free and earn rewards!

Have you used JTB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...