katanin-p80 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37906

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all katanin-p80 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 400-500 of human katanin-p80 (NP_005877.2).

Sequence:
SEPFPAPPEDDAATAKEAAKPSPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQAELVDEDAMSQIRKGHDTMCV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

72 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for katanin-p80 Antibody - BSA Free

katanin-p80 Antibody

Western Blot: katanin-p80 Antibody [NBP3-37906] -

Western Blot: katanin-p80 Antibody [NBP3-37906] - Western blot analysis of various lysates using katanin-p80 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
katanin-p80 Antibody

Immunocytochemistry/ Immunofluorescence: katanin-p80 Antibody [NBP3-37906] -

Immunocytochemistry/ Immunofluorescence: katanin-p80 Antibody [NBP3-37906] - Immunofluorescence analysis of NIH/3T3 cells using katanin-p80 Rabbit pAb at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for katanin-p80 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: katanin-p80

Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help toorganize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60subunit A 1) and an 80 kDa accessory protein (p80 subunit B 1). The p60 subunit acts to sever and disassemblemicrotubules, while the p80 subunit targets the enzyme to the centrosome. Katanin is a member of the AAA family ofATPases. (provided by RefSeq)

Alternate Names

KAT, katanin (80 kDa), katanin p80 (WD repeat containing) subunit B 1, katanin p80 (WD40-containing) subunit B 1, Katanin p80 subunit B1, katanin p80 WD40-containing subunit B1, p80 katanin

Gene Symbol

KATNB1

Additional katanin-p80 Products

Product Documents for katanin-p80 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for katanin-p80 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for katanin-p80 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review katanin-p80 Antibody - BSA Free and earn rewards!

Have you used katanin-p80 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies