KDM6A Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-80628
Loading...
Key Product Details
Validated by
Orthogonal Validation
Species Reactivity
Validated:
Human
Cited:
Human, Mouse
Predicted:
Rat (94%). Backed by our 100% Guarantee.
Applications
Validated:
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Cited:
Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Chemotaxis, IF/IHC, Knockdown Validated
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT
Reactivity Notes
Mouse reactivity reported from a verified customer review.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for KDM6A Antibody - BSA Free
Western Blot: KDM6A Antibody [NBP1-80628]
KDM6A-Antibody-Western-Blot-NBP1-80628-img0022.jpgWestern Blot: KDM6A Antibody [NBP1-80628]
Western Blot: KDM6A Antibody [NBP1-80628] - Analysis in human cell line HEK 293.Western Blot: KDM6A Antibody [NBP1-80628]
Western Blot: KDM6A Antibody [NBP1-80628] - MCF-7 and MDA-MB-231 whole cell lysates (40 ug/lane). 10% SDS-PAGE. KDM6A Antibody (NBP1-80628) primary antibody at 1:1000, 4C, overnight. Western blot image submitted by a verified customer review.Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628]
Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Red: UTX nuclear colocalization with DAPI (in blue). Image submitted by a verified customer review.Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628]
Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human bone marrow shows high expression.Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628]
Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human cervix shows moderate to strong nuclear positivity in squamous epithelial cells.Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628]
Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628]
Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human lymph node shows moderate to strong nuclear positivity in germinal center cells.Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628]
Immunohistochemistry-Paraffin: KDM6A Antibody [NBP1-80628] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Applications for KDM6A Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04 - 0.4 ug/mL
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 2 reviews rated 5 using NBP1-80628 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Lysine (K)-specific Demethylase 6A/KDM6A/UTX
Alternate Names
KABUK2, KDM6A, Lysine (K)specific Demethylase 6A, UTX
Entrez Gene IDs
7403 (Human)
Gene Symbol
KDM6A
Additional Lysine (K)-specific Demethylase 6A/KDM6A/UTX Products
Product Documents for KDM6A Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for KDM6A Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for KDM6A Antibody - BSA Free
Customer Reviews for KDM6A Antibody - BSA Free (2)
5 out of 5
2 Customer Ratings
Have you used KDM6A Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
2 of
2 reviews
Showing All
Filter By:
-
Application: Western BlotSample Tested: breast cancer cell line, Sample Amount: 40Species: HumanVerified Customer | Posted 02/26/2021Western Blot: MCF-7 and MDA-MB-231 whole cell lysates were loaded with 40 ug/lane. 10% SDS-PAGE. KDM6A Antibody (NBP1-80628) primary antibody: 1:1000, 4℃, overnight.
-
Application: Immunohistochemistry-ParaffinSample Tested: mouse uterusSpecies: MouseVerified Customer | Posted 01/19/2017Red: UTX nuclear colocalization with DAPI (in blue)Mouse uterus fixed in 4% PFA overnight. Citrate buffer retrieval, boiling for 10 minutes.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...