Kir3.4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88081

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQETY

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%). Reactivity reported in scientific literature (PMID: 23913004)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Kir3.4 Antibody - BSA Free

Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081]

Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081]

Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081] - Analysis in human adrenal gland and skeletal muscle tissues. Corresponding Kir3.4 RNA-seq data are presented for the same tissues.
Kir3.4 Antibody - BSA Free Immunohistochemistry-Paraffin: Kir3.4 Antibody - BSA Free [NBP1-88081]

Immunohistochemistry-Paraffin: Kir3.4 Antibody - BSA Free [NBP1-88081]

Staining of human adrenal gland shows moderate to strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081]

Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081]

Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081]

Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081]

Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081] - Staining of human pancreas shows moderate to strong membranous positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081]

Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081]

Immunohistochemistry-Paraffin: Kir3.4 Antibody [NBP1-88081] - Staining of human skin shows no positivity in squamous epithelial cells as expected.
Kir3.4 Antibody - BSA Free Western Blot: Kir3.4 Antibody - BSA Free [NBP1-88081]

Western Blot: Kir3.4 Antibody - BSA Free [NBP1-88081]

Analysis in control (vector only transfected HEK293T lysate) and kCNJ5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for Kir3.4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC reported in scientific literature (PMID: 25776071). For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Kir3.4

G-protein regulated inward-rectifier potassium channels (GIRK) are part of a superfamily of inward-rectifier K+ channels. To date four GIRK subunits, designated GIRK1-4 (also designated Kir3.1-4), have been identified in mammals, and GIRK5 has been found in Xenopus oocytes. GIRK channels exist in vivo both as homotetramers and heterotetramers. GIRK channels are modulated by G-proteins; they are also modulated by phosphatidylinositol 4,5-bisphosphate, intracellular sodium, ethanol and mechanical stretch. GIRK1, 2 and 3 are highly abundant in brain. In general, neuronal GIRK channels are involved in the regulation of the excitability of neurons and may contribute to the resting potential.

Alternate Names

Cardiac inward rectifier, CIRKIR3.4, G protein-activated inward rectifier potassium channel 4, GIRK-4, GIRK4Kir3.4, Heart KATP channel, Inward rectifier K(+) channel Kir3.4, inward rectifier K+ channel KIR3.4, IRK-4, KATP-1, KATP1cardiac ATP-sensitive potassium channel, LQT13, Potassium channel, inwardly rectifying subfamily J member 5, potassium inwardly-rectifying channel, subfamily J, member 5

Gene Symbol

KCNJ5

Additional Kir3.4 Products

Product Documents for Kir3.4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Kir3.4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Kir3.4 Antibody - BSA Free

Customer Reviews for Kir3.4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Kir3.4 Antibody - BSA Free and earn rewards!

Have you used Kir3.4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...