KPNA5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38715

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQK

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KPNA5 Antibody - BSA Free

Immunohistochemistry-Paraffin: KPNA5 Antibody [NBP2-38715]

Immunohistochemistry-Paraffin: KPNA5 Antibody [NBP2-38715]

Immunohistochemistry-Paraffin: KPNA5 Antibody [NBP2-38715] - Staining in human testis and endometrium tissues using anti-KPNA5 antibody. Corresponding KPNA5 RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: KPNA5 Antibody [NBP2-38715]

Immunocytochemistry/ Immunofluorescence: KPNA5 Antibody [NBP2-38715]

Immunocytochemistry/Immunofluorescence: KPNA5 Antibody [NBP2-38715] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: KPNA5 Antibody [NBP2-38715]

Immunohistochemistry-Paraffin: KPNA5 Antibody [NBP2-38715]

Immunohistochemistry-Paraffin: KPNA5 Antibody [NBP2-38715] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: KPNA5 Antibody [NBP2-38715]

Immunohistochemistry-Paraffin: KPNA5 Antibody [NBP2-38715]

Immunohistochemistry-Paraffin: KPNA5 Antibody [NBP2-38715] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Applications for KPNA5 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KPNA5

The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus.

Alternate Names

importin alpha 6, importin subunit alpha-6, IPOA6, karyopherin alpha 5 (importin alpha 6), Karyopherin subunit alpha-5, SRP6

Gene Symbol

KPNA5

UniProt

Additional KPNA5 Products

Product Documents for KPNA5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KPNA5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KPNA5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KPNA5 Antibody - BSA Free and earn rewards!

Have you used KPNA5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...