KPNA6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83762

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all KPNA6 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: RRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for KPNA6 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: KPNA6 Antibody [NBP1-83762]

Immunocytochemistry/ Immunofluorescence: KPNA6 Antibody [NBP1-83762]

Immunocytochemistry/Immunofluorescence: KPNA6 Antibody [NBP1-83762] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762]

Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762]

Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762] - Staining of human liver shows no positivity as expected.
Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762]

Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762]

Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762] - Staining of human cerebral cortex shows moderate to strong nuclear and cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762]

Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762]

Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762] - Staining of human testis shows moderate to strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762]

Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762]

Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762] - Staining of human adrenal gland shows moderate to strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762]

Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762]

Immunohistochemistry-Paraffin: KPNA6 Antibody [NBP1-83762] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubules.
KPNA6 Antibody - BSA Free Western Blot: KPNA6 Antibody - BSA Free [NBP1-83762]

Western Blot: KPNA6 Antibody - BSA Free [NBP1-83762]

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp

Applications for KPNA6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: KPNA6

Nucleocytoplasmic transport, a signal- and energy-dependent process, takes place through nuclear pore complexes embedded in the nuclear envelope. The import of proteins containing a nuclear localization signal (NLS) requires the NLS import receptor, a heterodimer of importin alpha and beta subunits also known as karyopherins. Importin alpha binds the NLS-containing cargo in the cytoplasm and importin beta docks the complex at the cytoplasmic side of the nuclear pore complex. In the presence of nucleoside triphosphates and the small GTP binding protein Ran, the complex moves into the nuclear pore complex and the importin subunits dissociate. Importin alpha enters the nucleoplasm with its passenger protein and importin beta remains at the pore. The protein encoded by this gene is a member of the importin alpha family. [provided by RefSeq]

Alternate Names

importin alpha 7 subunit, importin subunit alpha-7, importin-alpha-S2, IPOA7FLJ11249, karyopherin alpha 6 (importin alpha 7), Karyopherin subunit alpha-6, KPNA7, MGC17918

Gene Symbol

KPNA6

Additional KPNA6 Products

Product Documents for KPNA6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for KPNA6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KPNA6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KPNA6 Antibody - BSA Free and earn rewards!

Have you used KPNA6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies