KRR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-38099

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-381 of human KRR1 (NP_008974.5).

Sequence:
MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVVLDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

44 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for KRR1 Antibody - BSA Free

KRR1 Antibody

Immunocytochemistry/ Immunofluorescence: KRR1 Antibody [NBP3-38099] -

Immunocytochemistry/ Immunofluorescence: KRR1 Antibody [NBP3-38099] - Confocal Immunofluorescent analysis of U2OS cells using KRR1 Rabbit pAb at dilution of 1:100 (40x lens)(red). Vimentin for Cytoskeleton staining(green), DAPI for nuclear staining(blue).
KRR1 Antibody

Western Blot: KRR1 Antibody [NBP3-38099] -

Western Blot: KRR1 Antibody [NBP3-38099] - Western blot analysis of various lysates using KRR1 Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 1s.
KRR1 Antibody

Immunocytochemistry/ Immunofluorescence: KRR1 Antibody [NBP3-38099] -

Immunocytochemistry/ Immunofluorescence: KRR1 Antibody [NBP3-38099] - Confocal Immunofluorescent analysis of U2OS cells using KRR1 Rabbit pAb at dilution of 1:100 (40x lens)(red). beta-Actin for Cytoskeleton staining(green), DAPI for nuclear staining(blue).
KRR1 Antibody

Immunocytochemistry/ Immunofluorescence: KRR1 Antibody [NBP3-38099] -

Immunocytochemistry/ Immunofluorescence: KRR1 Antibody [NBP3-38099] - Confocal immunofluorescence analysis of U2OS cells using KRR1 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Applications for KRR1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: KRR1

KRR1 is required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly

Alternate Names

HIV-1 Rev binding protein 2, HIV-1 Rev-binding protein 2, HRB2, KRR1 small subunit processome component homolog, KRR1, small subunit (SSU) processome component, homolog (yeast), Rev interacting protein, Rev-interacting protein 1, RIP-1

Gene Symbol

KRR1

Additional KRR1 Products

Product Documents for KRR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for KRR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for KRR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review KRR1 Antibody - BSA Free and earn rewards!

Have you used KRR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...