Loading...
Key Product Details
Validated by
Biological Validation
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MESALAVPRLPPHDPGTPVLSVVDMHTGGEPLRIVLAGCPEVSGPTLLAKRRYMRQHLDHVRRRLMFEPRGHRDMYGAVLVPSEL
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (89%)
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for L3HYPDH Antibody - BSA Free
Western Blot: L3HYPDH Antibody [NBP2-31648]
Western Blot: L3HYPDH Antibody [NBP2-31648] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line U-87 MGImmunohistochemistry-Paraffin: L3HYPDH Antibody [NBP2-31648]
Immunohistochemistry-Paraffin: L3HYPDH Antibody [NBP2-31648] - L3HYPDH at 1:25, using EDTA pre-treatment, on WHO grade I and II meningioma cell lysates on paraffin slides. Relatively weak staining requiring a very high antibody concentration to obtain good quality tissue stains. Image submitted by a verified customer review.Immunohistochemistry-Paraffin: L3HYPDH Antibody [NBP2-31648]
Immunohistochemistry-Paraffin: L3HYPDH Antibody [NBP2-31648] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.Staining of human skeletal muscle shows no positivity in myocytes as expected.
Staining of human skeletal muscle shows no positivity in myocytes as expected.Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Staining of human pancreas shows no positivity in exocrine glandular cells as expected.Applications for L3HYPDH Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:50 - 1:200
Immunohistochemistry-Paraffin
1:50 - 1:200
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. L3HYPDH antibody validated for IHC-P from a verified customer review.
Reviewed Applications
Read 1 review rated 4 using NBP2-31648 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: L3HYPDH
Alternate Names
C14orf149, chromosome 14 open reading frame 149, EC 5.1.1.4, FLJ25436, probable proline racemase, proline racemase-like
Gene Symbol
L3HYPDH
UniProt
Additional L3HYPDH Products
Product Documents for L3HYPDH Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for L3HYPDH Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for L3HYPDH Antibody - BSA Free (1)
4 out of 5
1 Customer Rating
Have you used L3HYPDH Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Western BlotSample Tested: IHC-P Sample Tested, whole cell lysate, Sample Amount: 40 ug and Tissue LysatesSpecies: HumanVerified Customer | Posted 04/11/2019L3HYPDH at 1:25, using EDTA pre-treatment, on WHO grade I and II meningioma paraffin slides. Relatively weak staining requiring a very high antibody concentration to obtain good quality tissue stains.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...